SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17290

Feature Type:gene_model
Chromosome:Gm08
Start:12804468
stop:12808620
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g17290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64670AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L18e/L15 superfamily protein | chr5:25852535-25853880 REVERSE LENGTH=281 SoyBaseE_val: 1.00E-135ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0846 KOG Mitochondrial/chloroplast ribosomal protein L15/L10 JGI ISS
PTHR12934Panther 50S RIBOSOMAL PROTEIN L15 JGI ISS
PTHR12934:SF1Panther gb def: y92h12br.8.p [caenorhabditis elegans] JGI ISS
PF00828PFAM Ribosomal protein L18e/L15 JGI ISS
UniRef100_D7MRW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L15 family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MRW5_ARALL SoyBaseE_val: 2.00E-133ISS
UniRef100_I1KTV3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTV3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g17290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g17290
ParalogEvidenceComments
Glyma15g41870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g17290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g162600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g17290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g17290
>Glyma08g17290.1   sequence type=CDS   gene model=Glyma08g17290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCAGACGGAGGCTATCTGTTCTCTCAACATCAATCACCAGAAGCTCAAATTATAGCAAACCCAGTCTCGGATACCCATCTATCCAATCTCATCCCTTTCAGCTCCCTCACTCTCCCAGTGCTTATCAAATAATTAGTCCTAATGCATTCCCGGATTTTCAAGGTTTTAGAGCTTACAGTCTTCTGAGCTTGAATGATCTGAGAGATAAGGTTCCCAGAAAACAGCCGACGAGGAAGGGGCGTGGGATTGGGTCTGGAAAGGGCAAGACTGCAGGGAGGGGTCACAAGGGTCAGAGAGCCAGAAAAGGTATAAAATTGGGGTTCGAAGGAGGTCAGACCCCTCTTCGCCGAAGATTACCCAAACGTGGGTTCAAGAACCCATTTAGCCTCACTTTTCAGCCAATAGGTTTGGGGAAAATTGCAAAGTTTATTAATGCTGGGAAGATAGATTCTTCTGAACTGATTACAATGAAAACACTAAAGGATGCAGGGGTACTAGGGAAGCAAATGAAAGATGGAGTAAGATTGATGGGGCGTGGTTCTGAGCAGATCAAGTGGCCAATTCATCTAGAGGTATCAAGGGTTACTGTTAGGGCTAAGGAAGCAGTTGAAGCAGCTGGTGGGTCTGTGAGAAGGGTGTATTACAATAAGTTGGGCTTGAAGGCACTGGTGAAGCCTGAGTGGTTTGAAAAGAAAGGAAGATTGCTGCCTAAAGCAGCTAGACCTCCTCCAAAGCAAAAGGATAAAGTTGATAGCATTGGTCGGTTGCCTGCCCCAACAAAGCCATTTCCATTTTTAGTTGAAGCAAGCAAGGATCTTCCAGTTCAGCATCTTAGTTGA
Predicted protein sequences of Glyma08g17290
>Glyma08g17290.1   sequence type=predicted peptide   gene model=Glyma08g17290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRRRLSVLSTSITRSSNYSKPSLGYPSIQSHPFQLPHSPSAYQIISPNAFPDFQGFRAYSLLSLNDLRDKVPRKQPTRKGRGIGSGKGKTAGRGHKGQRARKGIKLGFEGGQTPLRRRLPKRGFKNPFSLTFQPIGLGKIAKFINAGKIDSSELITMKTLKDAGVLGKQMKDGVRLMGRGSEQIKWPIHLEVSRVTVRAKEAVEAAGGSVRRVYYNKLGLKALVKPEWFEKKGRLLPKAARPPPKQKDKVDSIGRLPAPTKPFPFLVEASKDLPVQHLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo