Glyma08g17190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17190

Feature Type:	gene_model
Chromosome:	Gm08
Start:	12652299
stop:	12653979
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g17190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G18370	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr2:7980687-7981475 FORWARD LENGTH=116	SoyBase	E_val: 5.00E-38	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_G7IQQ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=G7IQQ8_MEDTR	SoyBase	E_val: 1.00E-55	ISS
UniRef100_I1KTU5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTU5_SOYBN	SoyBase	E_val: 6.00E-91	ISS

Expression Patterns of Glyma08g17190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g17190

Paralog	Evidence	Comments
Glyma15g42000	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g17190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g161700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g17190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g17190

Limit To All Plant Sequences

>Glyma08g17190.1   sequence type=CDS   gene model=Glyma08g17190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAAAAAAGAACGAGATCAAAATTCATACCAGCATCATCATCATTTATCATTCTCTTTTCAGCAACCATGAAATCTTCAGGAGCATTAGCTACCCTTGTGCTTCTGATCCTACTTCTCGCCACAACTTCAGAGGCTGCAATTTCATGCAGTGATGTGATCAAGGACTTGAGGCCATGTGTGAGCTACTTGGTGAGTGGCAGTGGACAGCCACCAGCTGCTTGTTGCTCAGGAGCTAAAGCTCTTGCCTCTGCTGCAACAACCTCAGAGGACAAGAAGGCTGCTTGCAACTGCATCAAATCCACTTCCAAGAGTATCAACATTAACTCACAACTGGCTCAGGCTCTTCCGGGGAACTGTGGAATAACCCTTCCTGTGGCTATCTCTCCCAATGCTGATTGTTCCAAGGTTGGTTGA

Predicted protein sequences of Glyma08g17190

Limit To All Plant Sequences

>Glyma08g17190.1   sequence type=predicted peptide   gene model=Glyma08g17190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKKRTRSKFIPASSSFIILFSATMKSSGALATLVLLILLLATTSEAAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSININSQLAQALPGNCGITLPVAISPNADCSKVG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain