SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17140

Feature Type:gene_model
Chromosome:Gm08
Start:12591175
stop:12594893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g17140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79580AT Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein | chr1:29941020-29942925 REVERSE LENGTH=371 SoyBaseE_val: 5.00E-114ISS
GO:0003002GO-bp Annotation by Michelle Graham. GO Biological Process: regionalization SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009834GO-bp Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis SoyBaseN/AISS
GO:0010455GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell fate commitment SoyBaseN/AISS
GO:0048829GO-bp Annotation by Michelle Graham. GO Biological Process: root cap development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_A2Q3I9UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain-containing protein n=1 Tax=Medicago truncatula RepID=A2Q3I9_MEDTR SoyBaseE_val: 7.00E-180ISS
UniRef100_I1KTT9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTT9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g17140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g17140
ParalogEvidenceComments
Glyma15g42050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g17140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g161300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g17140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g17140
>Glyma08g17140.1   sequence type=CDS   gene model=Glyma08g17140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCAGGCAATGGACAGTTAACAGTTCCTCCGGGCTTCAGGTTCCACCCTACTGATGAGGAGCTTCTCTACTATTACCTGAGGAAGAAAGTTTCTTATGAAGCCATTGATCTTGATGTCATAAGAGAAGTAGATCTCAACAAACTTGAGCCTTGGGACCTCAATGATAAGTGTAGGATTGGGTCAGGGCCTCAGAATGAGTGGTATTTCTTCAGCCACAAGGACAAGAAGTACCCAACAGGAACCAGAACAAACCGAGCAACTACAGCTGGGTTTTGGAAAGCAACTGGGAGGGACAAGGCCATATACCACACTAATTCCAAGAGGATTGGCATGAGGAAAACCCTAGTTTTCTACACTGGTCGTGCTCCTCATGGCCAAAAGACTGATTGGATCATGCATGAGTATCGCCTTGATGAAGATGATGCTGATATTCAAGAAGATGGGTGGGTGGTATGCAGGGTGTTCAAAAAGAAAAGCCAAAACCGAGGTTTCCAGCAAGAAATTGAAGAAGAAGAGCACTTAACCACCCATATGAGAGCAAGTGGTCATTGCCAGGTCCTAGAGCCAAAGCATCATCACATGCAACAAGGACTCTATGATCACTACAACTTCGATGGGACAATGCATCTCCCACAGTTGTTCAGTCAAGAATCAGCAGTTGCACCACCCACAAATTCTTCCTTGGCCTCATCTATGAATGCCATGGACATCCTTCAGTGCTCTCAAAACCTCCTGAGGCTCACAACCACTACTGGCTGTGGACTTAATCTCATGCAGCAGCAACAACAACAAGGAGAGAGGTTCAGTGGTGACTGGTCTTTCTTGGACAAGCTACTAGCATCACACCATGGCATGGATCAAAGCAAATGTAACCCTCCTACTCATCATCAAGGTGCAAGTGTGGGAACTTCAGCTCAGAAATTCCCATTTCATTACCTTGGCTGTGACACCACCCATGATATCATGAAATTTTCCAAGTAG
Predicted protein sequences of Glyma08g17140
>Glyma08g17140.1   sequence type=predicted peptide   gene model=Glyma08g17140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDLDVIREVDLNKLEPWDLNDKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYHTNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLDEDDADIQEDGWVVCRVFKKKSQNRGFQQEIEEEEHLTTHMRASGHCQVLEPKHHHMQQGLYDHYNFDGTMHLPQLFSQESAVAPPTNSSLASSMNAMDILQCSQNLLRLTTTTGCGLNLMQQQQQQGERFSGDWSFLDKLLASHHGMDQSKCNPPTHHQGASVGTSAQKFPFHYLGCDTTHDIMKFSK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo