SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17053

Feature Type:gene_model
Chromosome:Gm08
Start:12499930
stop:12500543
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g17053
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62720AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR-like) superfamily protein | chr1:23227574-23229031 FORWARD LENGTH=485 SoyBaseE_val: 4.00E-21ISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_G7KK85UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7KK85_MEDTR SoyBaseE_val: 2.00E-38ISS
UniRef100_UPI0002338E5CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338E5C related cluster n=1 Tax=unknown RepID=UPI0002338E5C SoyBaseE_val: 9.00E-47ISS

Expression Patterns of Glyma08g17053
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17053 not represented in the dataset
Glyma08g17053 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g17053 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g160300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g17053
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g17053
>Glyma08g17053.1   sequence type=CDS   gene model=Glyma08g17053   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAATCTACATCACAATTATTAACGGTGTATGTAAAGATAAGCTTGTATCCGAGGCTTGCGATTTATACTGTGTAATGGCTGTCAAGGAAATTTCTGCTGATGTTGTCACTTATAATTCTCTAATTTATGGCTTATGCATTGTTGAAGGAAAGGTAAAAGAAGCCAAAAATACGTTAGCTTTGATGCTGAAAGCACATTTGAAACCTGATGTTGTAACTTATAATAATGGAAGGCTATTTTTTAATGAAGTGAAGAATGCAAAACAAGTATTCAAAGCTATGGCTCAAAGGGGAGATAAAAGGGTGGATGAAGCTATTCTCTTTAAGGAAATGCATCAGAAAAATATGGTACTTGACACAGTGACTTATAATTCTCTTGTTGATGGTTTGTGCAAATCTGGGAGAATCCCTTATGTTTGGAATCTTATTGATGAGATGCAGAGGTCAACCAACAAATGTAATAGGTGA
Predicted protein sequences of Glyma08g17053
>Glyma08g17053.1   sequence type=predicted peptide   gene model=Glyma08g17053   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVIYITIINGVCKDKLVSEACDLYCVMAVKEISADVVTYNSLIYGLCIVEGKVKEAKNTLALMLKAHLKPDVVTYNNGRLFFNEVKNAKQVFKAMAQRGDKRVDEAILFKEMHQKNMVLDTVTYNSLVDGLCKSGRIPYVWNLIDEMQRSTNKCNR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo