SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g17030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g17030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g17030

Feature Type:gene_model
Chromosome:Gm08
Start:12488599
stop:12491587
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g17030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07950AT Annotation by Michelle Graham. TAIR10: Surfeit locus protein 5 subunit 22 of Mediator complex | chr1:2466061-2466982 REVERSE LENGTH=154 SoyBaseE_val: 6.00E-57ISS
GO:0006357GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016592GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mediator complex SoyBaseN/AISS
KOG3304 KOG Surfeit family protein 5 JGI ISS
PTHR12434Panther FAMILY NOT NAMED JGI ISS
PTHR12434:SF3Panther SUBFAMILY NOT NAMED JGI ISS
PF06179PFAM Surfeit locus protein 5 subunit 22 of Mediator complex JGI ISS
UniRef100_G7IT38UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mediator of RNA polymerase II transcription subunit n=1 Tax=Medicago truncatula RepID=G7IT38_MEDTR SoyBaseE_val: 7.00E-82ISS
UniRef100_I1KTS9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTS9_SOYBN SoyBaseE_val: 1.00E-109ISS

Expression Patterns of Glyma08g17030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17030 not represented in the dataset
Glyma08g17030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g17030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g160100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g17030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g17030
>Glyma08g17030.1   sequence type=CDS   gene model=Glyma08g17030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAAAGGTGCAGCCGGAGGATTAGGGGGCGGCGCTGGCGCCGGAAGCGGGCCCACTGCGGCTGCGGCGGCGGCGGCGGCGCAGAAGCGGAAGACTCTGGTGCAAAGAGTCGAAGGCGATATCGCCAACATCGTCGACAATTTCAGCCACCTTGTCAACGTTGCAAGGGTAAATGATCCACTAGTTAGAAATTCACAGGAAGCTTTTATGATGGAGATGCGTGCTGCTAGGATGGTCCAGGCAGCTGATTCTCTATTGAAGTTGGTGTCAGAGCTTAAGCAAACTGCAATATTTTCAGGATTTGCCTCTCTTAATGATCATGTAGAACAAAGAAGGATTGAATTTAATCAGCTGGCAGAAAAAACAGATCACACATTATCCAGAGTAGGGGAGGAAGCTGCTGCTAGCCTAAAAGAACTTGAATCTCATTATTCTTCTTCTGCACTGAAGACTATGCAAAACCTGCAGCCATAG
Predicted protein sequences of Glyma08g17030
>Glyma08g17030.1   sequence type=predicted peptide   gene model=Glyma08g17030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNKGAAGGLGGGAGAGSGPTAAAAAAAAQKRKTLVQRVEGDIANIVDNFSHLVNVARVNDPLVRNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRRIEFNQLAEKTDHTLSRVGEEAAASLKELESHYSSSALKTMQNLQP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo