SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g17020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g17020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g17020

Feature Type:gene_model
Chromosome:Gm08
Start:12484212
stop:12487527
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g17020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79260AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Domain of unknown function DUF1794 (InterPro:IPR014878); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:29813282-29814066 FORWARD LENGTH=166 SoyBaseE_val: 1.00E-76ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3371 KOG Uncharacterized conserved protein JGI ISS
PTHR15854Panther THAP4 PROTEIN JGI ISS
PF08768PFAM Domain of unknown function (DUF1794) JGI ISS
UniRef100_B6T7L5UniRef Annotation by Michelle Graham. Most informative UniRef hit: THAP domain-containing protein 4 n=1 Tax=Zea mays RepID=B6T7L5_MAIZE SoyBaseE_val: 6.00E-79ISS
UniRef100_I1KTS8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTS8_SOYBN SoyBaseE_val: 2.00E-121ISS

Expression Patterns of Glyma08g17020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17020 not represented in the dataset
Glyma08g17020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g17020
ParalogEvidenceComments
Glyma15g42130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g17020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g160000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g17020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g17020
>Glyma08g17020.2   sequence type=CDS   gene model=Glyma08g17020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCAGAAACGGAGTCTCCGGCGCCGGAAACATCGCCGGCGGTGATCCACCCGGCAGTGGCACCAATCTCCTACCTTCTGGGCACATGGAGAGGCCAAGGAGAAGGAGGCTTCCCCACTATCAATTCCTTCTCCTATGGCGAAGAGCTTCACTTCTCACATTCCCCCAACAAGCCCGTGATAGGGTACACTCAGAAGACATGGAAACTCAGCTCTGGAGAGCCTATGCATGCTGAGAGTGGATACTGGCGTCCTAAACCTGATGGCACTATTGAAGTTGTGATTGCTCAAAGCAATGGTCTTGTGGAAGTTCAGAAAGGAACATACAGCGCTGAAGAGAAAGTGATACAGCTTCAGAGTGAAATAGTGGGGAACGCTTCTAAGGTTAAAGAGATAAGAAGATGTTTCCAGCTGGTTGATGGGAATCTTTGTTATGACGTTCAGATGGCTACCAATAAAATAACTCTTCAACCACACTTGAAAGCGTCACTGAAGAAGCTCTAA
Predicted protein sequences of Glyma08g17020
>Glyma08g17020.2   sequence type=predicted peptide   gene model=Glyma08g17020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDAETESPAPETSPAVIHPAVAPISYLLGTWRGQGEGGFPTINSFSYGEELHFSHSPNKPVIGYTQKTWKLSSGEPMHAESGYWRPKPDGTIEVVIAQSNGLVEVQKGTYSAEEKVIQLQSEIVGNASKVKEIRRCFQLVDGNLCYDVQMATNKITLQPHLKASLKKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo