SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16850

Feature Type:gene_model
Chromosome:Gm08
Start:12362808
stop:12363978
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31940AT Annotation by Michelle Graham. TAIR10: unknown protein; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 6 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G19875.1); Has 227 Blast hits to 227 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 227; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:13580600-13580962 FORWARD LENGTH=120 SoyBaseE_val: 9.00E-39ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
UniRef100_C6SYI5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYI5_SOYBN SoyBaseE_val: 8.00E-81ISS
UniRef100_D7LEB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxidoreductase/ transition metal ion binding protein n=2 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LEB2_ARALL SoyBaseE_val: 3.00E-38ISS

Expression Patterns of Glyma08g16850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g16850
ParalogEvidenceComments
Glyma15g42220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g16850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g158500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16850
>Glyma08g16850.1   sequence type=CDS   gene model=Glyma08g16850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTACCACTCTTCTCAAAATTCCCAACCTGCTCTCCCTATGCACCTATGTTTCTTCTTGCTCACCTTGTTCATGTTCCTTAGTTTCTCATTTTACTCAAGCTACGAGCCAATAATGGAGAGTTTCATGGACCAAGTGAAGTTGGTTCTAATGGTTTCTCCCCTTCTGCTTCTGCTAGTTGTGCACTTCCTTTGCAACTATGGTAGTGGAGGGGTTTTGTCTTCACTGATTCCTCTTCCAGAGAGAGAGTCACTGCACAGAGCAGGTGGAACTCCTTGGGGTGTTGGCTTGGTTCTTGTTCTTCTTCTCTTCATGGTGTCTTACCAGTCTTCTTTCCAGGAACGTTGGTTTCCTCTGCTCACAAGGTGA
Predicted protein sequences of Glyma08g16850
>Glyma08g16850.1   sequence type=predicted peptide   gene model=Glyma08g16850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAYHSSQNSQPALPMHLCFFLLTLFMFLSFSFYSSYEPIMESFMDQVKLVLMVSPLLLLLVVHFLCNYGSGGVLSSLIPLPERESLHRAGGTPWGVGLVLVLLLFMVSYQSSFQERWFPLLTR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo