Glyma08g16830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16830

Feature Type:	gene_model
Chromosome:	Gm08
Start:	12342546
stop:	12345204
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g16830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G60080	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr3:22187635-22188555 FORWARD LENGTH=306	SoyBase	E_val: 7.00E-25	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR22763	Panther	RING ZINC FINGER PROTEIN	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_I1KTQ8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTQ8_SOYBN	SoyBase	E_val: 5.00E-150	ISS
UniRef100_Q002B3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytokinesis negative regulator RCP1 n=1 Tax=Nicotiana tabacum RepID=Q002B3_TOBAC	SoyBase	E_val: 2.00E-29	ISS

Expression Patterns of Glyma08g16830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g16830

Paralog	Evidence	Comments
Glyma15g42250	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g16830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g158300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g16830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g16830

Limit To All Plant Sequences

>Glyma08g16830.1   sequence type=CDS   gene model=Glyma08g16830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGATCCGAAAGCCTACTGGTGCCACGAGTGCGACATGAGCGTGTCCCTGACGCTCCCACCCTCCCCTCTCCTCTGCCCGCACTGCCACACCCACTTCCTCGAGCTCATGGACTCCCCAACCCTCTCCCAAAACGACACCGAATCCTCCCTCTTCGACGTCGTTTTCCAAGACGCTCTCTTACTCCTCAACCCCCCTTCCTCAAAACCCCGCCCCCTCCCCTCCCTCCACGTCACCCCCTCCCTCCTCTCCTCCCTCGACCCCAACGGCGTCGTTCGCTGCGCCGTCTGCAAAGACCAAATTACCCCCCACGCCGAAGCCAAACAATTACCCTGCAAACACTTATACCACTCCGATTGCATCACGCCGTGGCTCGAACTCCACGCCTCGTGTCCGCTATGCAGGTTTCGGTTGGAAGAAGAGGAGGAAGAAGGCGGTGACGGCGTTATGACGAAGATCAGGAGGGAGATTATTGCCAGGCTGACGGTGCTGACGGAAGAGGATTTCTACGGGCTGAGGACCACGCTCAACCACATTGCCTCGCGCCACGCGCTCATCCAAGAGAACGAGAATCGCGGCGCCCAGATTGGGGAAACTCAAGGTGGCGATTCGGCTTGCTGA

Predicted protein sequences of Glyma08g16830

Limit To All Plant Sequences

>Glyma08g16830.1   sequence type=predicted peptide   gene model=Glyma08g16830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADPKAYWCHECDMSVSLTLPPSPLLCPHCHTHFLELMDSPTLSQNDTESSLFDVVFQDALLLLNPPSSKPRPLPSLHVTPSLLSSLDPNGVVRCAVCKDQITPHAEAKQLPCKHLYHSDCITPWLELHASCPLCRFRLEEEEEEGGDGVMTKIRREIIARLTVLTEEDFYGLRTTLNHIASRHALIQENENRGAQIGETQGGDSAC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain