SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g16790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g16790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g16790

Feature Type:gene_model
Chromosome:Gm08
Start:12317564
stop:12318841
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16790
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42140AT Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr2:17568964-17569482 REVERSE LENGTH=172 SoyBaseE_val: 1.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_D7LVY8UniRef Annotation by Michelle Graham. Most informative UniRef hit: VQ motif-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LVY8_ARALL SoyBaseE_val: 3.00E-18ISS
UniRef100_I1KTQ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTQ6_SOYBN SoyBaseE_val: 3.00E-98ISS

Proteins Associated with Glyma08g16790
LocusGene SymbolProtein Name
VQ36 VQ motif containing protein gene 36

Expression Patterns of Glyma08g16790
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g16790 not represented in the dataset
Glyma08g16790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g16790
ParalogEvidenceComments
Glyma15g42280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g16790 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g157900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16790
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16790
>Glyma08g16790.1   sequence type=CDS   gene model=Glyma08g16790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAAAGCTAGGAATTAACAAAGATTCACATTTGGTCTCAAAAACCAAGCCAAAGATCAGGATAATTCATGTGTATACTCCAGAAATCATCAAAACTGATGCTGCAAATTTCAGAGAGTTGGTTCAAAGGCTCACAGGAAAGCCAAAAGAAGAAGGAACAGGTGGAAGCAAGTCCGAAACTGCACTAACCAAAGAACCAATGGATTCACACCCCAAGAAGGCCATGATCATGCAAGATGAAGAGGAGTTTCTGAGTCTACAAAATGGGACAAGGCTAAAGAATGAACATAAAGAGGAGGAAGTTCAAGATGATGTGTGGAGGTCAAAGTCAAACGAGAAGTTCAGTGGTTTCCTTGATGGGTTCTCAGAATTGGATGGTTTTATGGAAGAGTTAAGTACTTTGCCTGCAGGGAATCAAAATTAA
Predicted protein sequences of Glyma08g16790
>Glyma08g16790.1   sequence type=predicted peptide   gene model=Glyma08g16790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTKLGINKDSHLVSKTKPKIRIIHVYTPEIIKTDAANFRELVQRLTGKPKEEGTGGSKSETALTKEPMDSHPKKAMIMQDEEEFLSLQNGTRLKNEHKEEEVQDDVWRSKSNEKFSGFLDGFSELDGFMEELSTLPAGNQN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo