Report for Sequence Feature Glyma08g16680
Feature Type: gene_model
Chromosome: Gm08
Start: 12222424
stop: 12225882
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g16680
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G43890 AT
Annotation by Michelle Graham. TAIR10: RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212
SoyBase E_val: 5.00E-126 ISS
GO:0007264 GO-bp
Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0005525 GO-mf
Annotation by Michelle Graham. GO Molecular Function: GTP binding
SoyBase N/A ISS
KOG0080
KOG
GTPase Rab18, small G protein superfamily
JGI ISS
PTHR24073 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24073:SF482 Panther
JGI ISS
PF00071 PFAM
Ras family
JGI ISS
UniRef100_C6T2M4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T2M4_SOYBN
SoyBase E_val: 6.00E-150 ISS
UniRef100_G7JBL5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein yptV3 n=1 Tax=Medicago truncatula RepID=G7JBL5_MEDTR
SoyBase E_val: 2.00E-130 ISS
Expression Patterns of Glyma08g16680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g16680
Paralog Evidence Comments
Glyma05g32520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g16680 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g157000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g16680
Coding sequences of Glyma08g16680
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g16680.1 sequence type=CDS gene model=Glyma08g16680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATTCGAGTTCGGGGCATCAAGAATTCGATTATTTGTTTAAGTTGTTGATGATTGGAGACTCTGGGGTTGGCAAGAGTAGTCTTCTTCTCAGTTTCACCTCCGATGCTTTTGAAGATCTCTCCCCCACTATCGGTGTTGATTTTAAGGTCAAATATGTGATGATGGGGGGTAAAAAGCTGAAGCTTGCAATTTGGGATACTGCTGGTCAGGAGAGATTCAGAACACTGACAAGTTCTTACTACAGAGGGGCACAAGGAATCATCATGGTTTATGATGTAACCCGGCGAGATACATTTACAAATCTTTCTGAAATATGGGCAAAGGAAATAGACCTTTATTCAACTAATCAAGATTGCATCAAGATGCTTGTTGGAAACAAACTAGATAAGGACGGTGATAGAGTTGTGACAAAGAAAGAGGGAATAGACTTTGCCAGGGAATACGGTTGCCTATTTATTGAATGCAGTGCTAAAACTCGAGTTAATGTTCAGCAATGCTTTGAAGAGCTTGTTTTGAAGATTCTGGATACACCTAGCCTCATAGCCGAGGGCTCAAAGGGTGTTAAAAAGAACATTTTCAAGGACAGGCCACCCCAGTCTGATGCATCCGCAAGTAGTTGTTGCTGA
Predicted protein sequences of Glyma08g16680
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g16680.1 sequence type=predicted peptide gene model=Glyma08g16680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDSSSGHQEFDYLFKLLMIGDSGVGKSSLLLSFTSDAFEDLSPTIGVDFKVKYVMMGGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSEIWAKEIDLYSTNQDCIKMLVGNKLDKDGDRVVTKKEGIDFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLIAEGSKGVKKNIFKDRPPQSDASASSCC*