Glyma08g16506 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16506

Feature Type:	gene_model
Chromosome:	Gm08
Start:	12095499
stop:	12096495
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g16506

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G38840	AT	Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family \| chr4:18125174-18125473 REVERSE LENGTH=99	SoyBase	E_val: 2.00E-33	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02519	PFAM	Auxin responsive protein	JGI		ISS
UniRef100_I1KTN0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTN0_SOYBN	SoyBase	E_val: 1.00E-62	ISS
UniRef100_P32295	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid-induced protein ARG7 n=1 Tax=Vigna radiata var. radiata RepID=ARG7_VIGRR	SoyBase	E_val: 3.00E-52	ISS

Expression Patterns of Glyma08g16506

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g16506 not represented in the dataset	Glyma08g16506 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16506 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g155500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g16506

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g16506

Limit To All Plant Sequences

>Glyma08g16506.1   sequence type=CDS   gene model=Glyma08g16506   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTCCGTTTACCTGGTATCAGAAAGGGAATATTTGCAGCCAACCAAGCATCATCAAAAACGGTGGATGCACCAAAGGGCTACCTTGCAGTTTATGTTGGAGAGAAAATGAAGCGATTTGTGATCCCTGTGTCATACTTGAACCAACCTTCATTTCAAGACTTGTTGAGTCGAGCTGAGGAAGAGTTTGGATATGATCATCCCATGGGCGGCCTCACAATTCCTTGCAGCGAAGATGTCTTCCAACATATAACTTCTTGTTTGAATGGACAATAA

Predicted protein sequences of Glyma08g16506

Limit To All Plant Sequences

>Glyma08g16506.1   sequence type=predicted peptide   gene model=Glyma08g16506   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFRLPGIRKGIFAANQASSKTVDAPKGYLAVYVGEKMKRFVIPVSYLNQPSFQDLLSRAEEEFGYDHPMGGLTIPCSEDVFQHITSCLNGQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain