SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16500

Feature Type:gene_model
Chromosome:Gm08
Start:12094263
stop:12095012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38840AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr4:18125174-18125473 REVERSE LENGTH=99 SoyBaseE_val: 2.00E-30ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_P33079UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 10A5 n=2 Tax=Glycine max RepID=A10A5_SOYBN SoyBaseE_val: 3.00E-46ISS
UniRef100_UPI0002338105UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338105 related cluster n=1 Tax=unknown RepID=UPI0002338105 SoyBaseE_val: 3.00E-62ISS

Expression Patterns of Glyma08g16500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g155400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16500
>Glyma08g16500.2   sequence type=CDS   gene model=Glyma08g16500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTCCACATACCAGGTATTATTAGACAGACATTATTTTCTGCAACCAAAGCAACTCAAAAGGGACTCGAAGTTCCAAAAGGCTATCTTGCAGTCTATGTTGGAGATAAGATGAAGCGATTTGTGATTCCAGTATCATACTTGAACCAACCATTATTTCAAGAATTACTGAGTCAAGCAGAACAAGATTTTGGATATGATCATCCAACAGGTGGTCTCACAATTCCTTGCAAGGAGGATGACTTTCTAAACCTCACTTCTCACTTGAATGAGCTGTAA
Predicted protein sequences of Glyma08g16500
>Glyma08g16500.2   sequence type=predicted peptide   gene model=Glyma08g16500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFHIPGIIRQTLFSATKATQKGLEVPKGYLAVYVGDKMKRFVIPVSYLNQPLFQELLSQAEQDFGYDHPTGGLTIPCKEDDFLNLTSHLNEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo