Report for Sequence Feature Glyma08g16460
Feature Type: gene_model
Chromosome: Gm08
Start: 12076584
stop: 12077347
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g16460
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G52105 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr3:19323394-19323606 FORWARD LENGTH=70
SoyBase E_val: 1.00E-22 ISS
GO:0006661 GO-bp
Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_B7EG04 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: cDNA clone:J023009A03, full insert sequence n=2 Tax=Oryza RepID=B7EG04_ORYSJ
SoyBase E_val: 5.00E-09 ISS
UniRef100_I1KTM5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTM5_SOYBN
SoyBase E_val: 7.00E-40 ISS
Expression Patterns of Glyma08g16460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g16460
Paralog Evidence Comments
Glyma15g42930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g16460 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g155100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g16460
Coding sequences of Glyma08g16460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g16460.1 sequence type=CDS gene model=Glyma08g16460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTGCCTTTGTTCTTCTCAGTGGCTTTCTCTGCTGTGCCTCTGATCCTCTATATTCCACCACTCAGAAGCTTGAACCTCTTTGTTGAAACCATTGAAGACATGGCAAGAGAGTCAAGAATCCACACCAACAGGATCTACCCGCGCCTGCGTGTGGCTTGGTCAAGGGTCATGAATTGTATACTGTGCAACAGAACAAGGTAG
Predicted protein sequences of Glyma08g16460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g16460.1 sequence type=predicted peptide gene model=Glyma08g16460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLPLFFSVAFSAVPLILYIPPLRSLNLFVETIEDMARESRIHTNRIYPRLRVAWSRVMNCILCNRTR*