SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g16412): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g16412): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g16412

Feature Type:gene_model
Chromosome:Gm08
Start:12025015
stop:12029764
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16412
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26810AT Annotation by Michelle Graham. TAIR10: Putative methyltransferase family protein | chr2:11434317-11436078 REVERSE LENGTH=209 SoyBaseE_val: 9.00E-73ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR23108Panther METHYLTRANSFERASE-RELATED JGI ISS
PF10294PFAM Putative methyltransferase JGI ISS
UniRef100_B4FLD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine-dependent methyltransferase/ methyltransferase n=1 Tax=Zea mays RepID=B4FLD8_MAIZE SoyBaseE_val: 3.00E-71ISS
UniRef100_UPI00023380FFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023380FF related cluster n=1 Tax=unknown RepID=UPI00023380FF SoyBaseE_val: 3.00E-133ISS

Expression Patterns of Glyma08g16412
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g16412 not represented in the dataset
Glyma08g16412 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16412 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g154800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16412
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16412
>Glyma08g16412.1   sequence type=CDS   gene model=Glyma08g16412   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGCTGACGAAACTTGCAATTACGAACACAACAGTAACACTACCGCCGCAGAAGAGACCGAAACGCCGTCTTATTCATCTCCGAACACCGAATATGGAAGAAAGAGGAAACCAACACAAACACGAACAAGAAGAAGAAGAAGAAATCGTTTGCTTAGACGCGTCGTTCTTCGTCGATGACAATTACCAGCTGACGAAATTCACGTTCGGTTCGCAAGACATTCAGCTCTTCTGTCTGCATTCTGCTTCCACTGATTTTGATTTGACAGGGCAGCTGGTTTGGCCTGGAGCCATGTTGCTGAATGAGTATCTTTCAAAAAATGTTAACCTGCTTCAGGGTTGCACTGCCATTGAATTAGGTTCTGGTGTTGGTATTACCGGAATACTTTGCAGCAGATTCTGCCATAAAGTTGTGATGACAGATCATAATGAAGAAGTGATCAAGATCTTAAAGAAAAACATAGAGCTGCATTCATGTCCTGAGAATATTACTTCTATTTCTCATGGATTAGTAGCAGAGAAACTAGAATGGGGGAACACTGATCAGATAAATGAAATATTACAAAAACATCCTGGAGGTTTCGACTTCATACTTGGAGCTGATATATATATCCTTTATGTATGGATTCCCACTGTTATCATACTTAACTAG
Predicted protein sequences of Glyma08g16412
>Glyma08g16412.1   sequence type=predicted peptide   gene model=Glyma08g16412   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLTKLAITNTTVTLPPQKRPKRRLIHLRTPNMEERGNQHKHEQEEEEEIVCLDASFFVDDNYQLTKFTFGSQDIQLFCLHSASTDFDLTGQLVWPGAMLLNEYLSKNVNLLQGCTAIELGSGVGITGILCSRFCHKVVMTDHNEEVIKILKKNIELHSCPENITSISHGLVAEKLEWGNTDQINEILQKHPGGFDFILGADIYILYVWIPTVIILN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo