|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G26810 | AT | Annotation by Michelle Graham. TAIR10: Putative methyltransferase family protein | chr2:11433900-11436078 REVERSE LENGTH=256 | SoyBase | E_val: 1.00E-22 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_B4FLD8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine-dependent methyltransferase/ methyltransferase n=1 Tax=Zea mays RepID=B4FLD8_MAIZE | SoyBase | E_val: 5.00E-15 | ISS |
| UniRef100_I1KTM2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KTM2_SOYBN | SoyBase | E_val: 1.00E-40 | ISS |
|
Glyma08g16404 not represented in the dataset |
Glyma08g16404 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g154700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g16404.1 sequence type=CDS gene model=Glyma08g16404 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTTTTTGATAGTGTTAAACAGCTCCTGCAGGCTAGGGAGGACAGAAAGTGCAAATTCATTCTAGCCTATATATCAAGAGCTAAGACCATGGATTCAATGATTCTTATTGAAGCTTCTAAGCTACAGATGCAGATGAAAGAAGTGCCTGGAACTCGGTGCACAGTTAAGAATCTTGAAGGAGTCATCTTTGTAGTTACTCTTGAGTAG
>Glyma08g16404.1 sequence type=predicted peptide gene model=Glyma08g16404 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLFDSVKQLLQAREDRKCKFILAYISRAKTMDSMILIEASKLQMQMKEVPGTRCTVKNLEGVIFVVTLE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||