SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16404

Feature Type:gene_model
Chromosome:Gm08
Start:12022440
stop:12025001
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16404
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26810AT Annotation by Michelle Graham. TAIR10: Putative methyltransferase family protein | chr2:11433900-11436078 REVERSE LENGTH=256 SoyBaseE_val: 1.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B4FLD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine-dependent methyltransferase/ methyltransferase n=1 Tax=Zea mays RepID=B4FLD8_MAIZE SoyBaseE_val: 5.00E-15ISS
UniRef100_I1KTM2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KTM2_SOYBN SoyBaseE_val: 1.00E-40ISS

Expression Patterns of Glyma08g16404
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g16404 not represented in the dataset
Glyma08g16404 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16404 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g154700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16404
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16404
>Glyma08g16404.1   sequence type=CDS   gene model=Glyma08g16404   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTTTTGATAGTGTTAAACAGCTCCTGCAGGCTAGGGAGGACAGAAAGTGCAAATTCATTCTAGCCTATATATCAAGAGCTAAGACCATGGATTCAATGATTCTTATTGAAGCTTCTAAGCTACAGATGCAGATGAAAGAAGTGCCTGGAACTCGGTGCACAGTTAAGAATCTTGAAGGAGTCATCTTTGTAGTTACTCTTGAGTAG
Predicted protein sequences of Glyma08g16404
>Glyma08g16404.1   sequence type=predicted peptide   gene model=Glyma08g16404   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFDSVKQLLQAREDRKCKFILAYISRAKTMDSMILIEASKLQMQMKEVPGTRCTVKNLEGVIFVVTLE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo