SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g16100

Feature Type:gene_model
Chromosome:Gm08
Start:11736513
stop:11739611
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52150AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr3:19342074-19343090 FORWARD LENGTH=253 SoyBaseE_val: 5.00E-99ISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG0131 KOG Splicing factor 3b, subunit 4 JGI ISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF56Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7J1T1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein n=1 Tax=Medicago truncatula RepID=G7J1T1_MEDTR SoyBaseE_val: 6.00E-108ISS
UniRef100_I1KTJ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTJ9_SOYBN SoyBaseE_val: 2.00E-176ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g42610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g151700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g16100.1   sequence type=CDS   gene model=Glyma08g16100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCTTCATTCTTCTTTCCTCCTTACATCAAATTTTCTTTCCCTCACAACCCCATCAAGTTCTTCCACTCACGTTCTCTTTCCCATGAGACTCTCCACGACCCACTTGCGACCCCTTCTTCTCACCACACGACACGGTTTCGGGAGACCACCCTTTGCCGCGGTGGCGGAACAGGCGGCCACCGCGACCGAGGCGTCCGCGAGGAGGCTCTACGTTGGCAACATTCCCCGCACCGTCACCAACGAAGAGCTTGCCAAGATTGTTCAAGAACATGGTGCTGTTGAGAAAGCTGAGGTTATGTATGATAAATACTCTGGAAGGAGCCGCCGCTTTGCATTTGTTACGATGAAAACTGTTGAGGATGCAACTGCTGTGATTGAGAAACTTAACGGCACTGAAATTGGAGGACGTGAGGTCAAAGTAAACGTAACGGAAAAACCTTTATCAACACCAGATTTGCCTTTACTCCAAGCTGAGGAATCTGAATTTATTGACAGTCCCCACAAGGTGTATGTGGGAAATCTGGCCAAAACAGTAACAACTGATACTCTTAAAAACTTTTTTTCTGAGAAGGGAAAAGTTCTTAGTGCCAAGGTTTCACGGGTCCCTGGTACCTCAAAATCCAGTGGATATGGGTTTGTTACTTTTTCGTCAGAAGAGGATGTAGAAGCTGCAATCTCATCTTTCAACAATTCTTTGTTAGAAGGCCAAACAATCCGTGTAAACAAGGCATAG

>Glyma08g16100.1   sequence type=predicted peptide   gene model=Glyma08g16100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLHSSFLLTSNFLSLTTPSSSSTHVLFPMRLSTTHLRPLLLTTRHGFGRPPFAAVAEQAATATEASARRLYVGNIPRTVTNEELAKIVQEHGAVEKAEVMYDKYSGRSRRFAFVTMKTVEDATAVIEKLNGTEIGGREVKVNVTEKPLSTPDLPLLQAEESEFIDSPHKVYVGNLAKTVTTDTLKNFFSEKGKVLSAKVSRVPGTSKSSGYGFVTFSSEEDVEAAISSFNNSLLEGQTIRVNKA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo