Glyma08g16100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16100

Feature Type:	gene_model
Chromosome:	Gm08
Start:	11736513
stop:	11739611
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g16100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G52150	AT	Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein \| chr3:19342074-19343090 FORWARD LENGTH=253	SoyBase	E_val: 5.00E-99	ISS
GO:0009773	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
KOG0131	KOG	Splicing factor 3b, subunit 4	JGI		ISS
PTHR24012	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24012:SF56	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_G7J1T1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein n=1 Tax=Medicago truncatula RepID=G7J1T1_MEDTR	SoyBase	E_val: 6.00E-108	ISS
UniRef100_I1KTJ9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTJ9_SOYBN	SoyBase	E_val: 2.00E-176	ISS

Expression Patterns of Glyma08g16100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g16100

Paralog	Evidence	Comments
Glyma15g42610	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g16100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g151700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g16100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g16100

Limit To All Plant Sequences

>Glyma08g16100.1   sequence type=CDS   gene model=Glyma08g16100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCTTCATTCTTCTTTCCTCCTTACATCAAATTTTCTTTCCCTCACAACCCCATCAAGTTCTTCCACTCACGTTCTCTTTCCCATGAGACTCTCCACGACCCACTTGCGACCCCTTCTTCTCACCACACGACACGGTTTCGGGAGACCACCCTTTGCCGCGGTGGCGGAACAGGCGGCCACCGCGACCGAGGCGTCCGCGAGGAGGCTCTACGTTGGCAACATTCCCCGCACCGTCACCAACGAAGAGCTTGCCAAGATTGTTCAAGAACATGGTGCTGTTGAGAAAGCTGAGGTTATGTATGATAAATACTCTGGAAGGAGCCGCCGCTTTGCATTTGTTACGATGAAAACTGTTGAGGATGCAACTGCTGTGATTGAGAAACTTAACGGCACTGAAATTGGAGGACGTGAGGTCAAAGTAAACGTAACGGAAAAACCTTTATCAACACCAGATTTGCCTTTACTCCAAGCTGAGGAATCTGAATTTATTGACAGTCCCCACAAGGTGTATGTGGGAAATCTGGCCAAAACAGTAACAACTGATACTCTTAAAAACTTTTTTTCTGAGAAGGGAAAAGTTCTTAGTGCCAAGGTTTCACGGGTCCCTGGTACCTCAAAATCCAGTGGATATGGGTTTGTTACTTTTTCGTCAGAAGAGGATGTAGAAGCTGCAATCTCATCTTTCAACAATTCTTTGTTAGAAGGCCAAACAATCCGTGTAAACAAGGCATAG

Predicted protein sequences of Glyma08g16100

Limit To All Plant Sequences

>Glyma08g16100.1   sequence type=predicted peptide   gene model=Glyma08g16100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLHSSFLLTSNFLSLTTPSSSSTHVLFPMRLSTTHLRPLLLTTRHGFGRPPFAAVAEQAATATEASARRLYVGNIPRTVTNEELAKIVQEHGAVEKAEVMYDKYSGRSRRFAFVTMKTVEDATAVIEKLNGTEIGGREVKVNVTEKPLSTPDLPLLQAEESEFIDSPHKVYVGNLAKTVTTDTLKNFFSEKGKVLSAKVSRVPGTSKSSGYGFVTFSSEEDVEAAISSFNNSLLEGQTIRVNKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain