Glyma08g16080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16080

Feature Type:	gene_model
Chromosome:	Gm08
Start:	11724339
stop:	11725981
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g16080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42850	AT	Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein \| chr5:17182072-17182568 REVERSE LENGTH=134	SoyBase	E_val: 6.00E-53	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
KOG3425	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR12452	Panther	42-9-9 PROTEIN-RELATED	JGI		ISS
PF06110	PFAM	Eukaryotic protein of unknown function (DUF953)	JGI		ISS
UniRef100_G7J1S6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J1S6_MEDTR	SoyBase	E_val: 1.00E-78	ISS
UniRef100_I1KTJ7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTJ7_SOYBN	SoyBase	E_val: 8.00E-92	ISS

Expression Patterns of Glyma08g16080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g151500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g16080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g16080

Limit To All Plant Sequences

>Glyma08g16080.1   sequence type=CDS   gene model=Glyma08g16080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGTTGAAGGTGTTAGATGCCACAGTGTCGAGCTTTGATGGAGTGTTTGAGAAGTTCCGATCAGAGGCTCCAAAAAATAAGGCCAATCTCATCCTCTTCTTGGCTGACAAAGATCCTTCTACCTCTCTCAGCTGGTGCCCTGATTGTGTGAGAGCTGAACCTGTGATCTACAAGAAGCTAGAGGCTTCATCTGATGAGATTTCACTTTTGAGGGCTTATGTTGGAGATAGACCAACATGGAGGAACCCCCAACATCCATGGAGGGTGCAACCTAGGTTCAAGCTCACTGGGGTGCCAACCTTGATCCGTTGGGAGAATGACACAGTCAAAGCTCGCTTGGAGGATCATGAAGCTCACATTGAAAACAAAATTGAAGCTCTTGTTGCTGACAAGTAG

Predicted protein sequences of Glyma08g16080

Limit To All Plant Sequences

>Glyma08g16080.1   sequence type=predicted peptide   gene model=Glyma08g16080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLKVLDATVSSFDGVFEKFRSEAPKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKKLEASSDEISLLRAYVGDRPTWRNPQHPWRVQPRFKLTGVPTLIRWENDTVKARLEDHEAHIENKIEALVADK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain