SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g16057

Feature Type:gene_model
Chromosome:Gm08
Start:11716433
stop:11716886
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g16057
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28050AT Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr5:10044209-10045755 REVERSE LENGTH=185 SoyBaseE_val: 2.00E-37ISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0009218GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide metabolic process SoyBaseN/AISS
GO:0019690GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine deoxyribonucleoside interconversion SoyBaseN/AISS
GO:0019692GO-bp Annotation by Michelle Graham. GO Biological Process: deoxyribose phosphate metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR11079Panther CYTOSINE DEAMINASE JGI ISS
PTHR11079:SF18Panther SUBFAMILY NOT NAMED JGI ISS
PF00383PFAM Cytidine and deoxycytidylate deaminase zinc-binding region JGI ISS
UniRef100_A1YLY2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytidine/deoxycytidylate deaminase family protein n=1 Tax=Zea mays RepID=A1YLY2_MAIZE SoyBaseE_val: 2.00E-36ISS
UniRef100_C6T1R0UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T1R0_SOYBN SoyBaseE_val: 2.00E-39ISS

Expression Patterns of Glyma08g16057
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g16057 not represented in the dataset
Glyma08g16057 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g16057 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g151200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g16057
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g16057
>Glyma08g16057.1   sequence type=CDS   gene model=Glyma08g16057   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGCCTTATTTTTTTATAGATGTAATAAACTTTATGCAGTGTCAAAAAATGATTCATGCAGTGTTTTCATTTTACAGGCTTGCAAGAAGCTTAAGCAGATAGAACTTGCAGATTGTGAAATCTATGCTTCTTGTGAACCTTGCCCCATGTGCTTTGGTGCAATCCACCTTTCTCAAATTAAGTGGTTGGTTTATGGAGCGAAGGCTGACGCAGCAATTGCTATTGGGTTTCATGATTTCATTGCAGATGCACTGCGAGGTACTGGATTCTATCAGAAAGCAACATAG
Predicted protein sequences of Glyma08g16057
>Glyma08g16057.1   sequence type=predicted peptide   gene model=Glyma08g16057   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YALFFYRCNKLYAVSKNDSCSVFILQACKKLKQIELADCEIYASCEPCPMCFGAIHLSQIKWLVYGAKADAAIAIGFHDFIADALRGTGFYQKAT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo