SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g15993

Feature Type:gene_model
Chromosome:Gm08
Start:11664383
stop:11666222
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44480AT Annotation by Michelle Graham. TAIR10: beta glucosidase 17 | chr2:18360476-18363001 FORWARD LENGTH=415 SoyBaseE_val: 1.00E-72ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PTHR10353Panther GLYCOSIDE HYDROLASES JGI ISS
PF00232PFAM Glycosyl hydrolase family 1 JGI ISS
UniRef100_G7IZC8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-glucosidase n=1 Tax=Medicago truncatula RepID=G7IZC8_MEDTR SoyBaseE_val: 1.00E-101ISS
UniRef100_I1KTJ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTJ1_SOYBN SoyBaseE_val: 1.00E-159ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15993 not represented in the dataset

Glyma08g15993 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15993.1   sequence type=CDS   gene model=Glyma08g15993   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCTCGTCAAAAAGGACAAATTGGGATCACCCTTCCGACTCACTTCTTTTTGCCAAAATCAAATAGTGTTGCCGATAAACAAGCAGCAAATCGAGCTCTGGACTTTTTCTTTGGCTGGCATGCTCGTCCAGTTATATTTGGTGACTATCCTGAGAGTATGAAATCTTCAGTGGGTTCTAGACTACCTAAATTCACAAAAGCTCAATCTGAAGGTCTCAAAAGTTCCATTGATTTTCTTGGTGTAAATTATTACACCACATATTATGCAGAAAATGCTGCACCTGTAAGAGCCAACAGGACCTTCAACACAGATATGCTAGTCACTCTCAGTACGGAAAAGAATGGTGTGGCTATTGGGACCCCGACTGATTTGGATTGGCTCTATATCTATCCGAAGGGAATTCATCTTCTTATGGTACACATAAAGGATAAATACAAGAATCCAAATATTTACGTCAATGAAAATGGCATTGCTGAAGCAAGGAATGACTCAATACCAGTCGATGAAGCCCTTAATGATGGTATCAGGATTAGATACCTTAAGAGCCACCTTAGACTCCTTCTTCAAGCGATCAAGGAAGGTGTTAATGTGAAGGGCTACTATGCATGGTCATTTTCGGACAGCTTTGAATGGGATGCTGGTTACACAGTTCGATTTGGTCAC

>Glyma08g15993.1   sequence type=predicted peptide   gene model=Glyma08g15993   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ARQKGQIGITLPTHFFLPKSNSVADKQAANRALDFFFGWHARPVIFGDYPESMKSSVGSRLPKFTKAQSEGLKSSIDFLGVNYYTTYYAENAAPVRANRTFNTDMLVTLSTEKNGVAIGTPTDLDWLYIYPKGIHLLMVHIKDKYKNPNIYVNENGIAEARNDSIPVDEALNDGIRIRYLKSHLRLLLQAIKEGVNVKGYYAWSFSDSFEWDAGYTVRFGH







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo