Glyma08g15860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g15860

Feature Type:	gene_model
Chromosome:	Gm08
Start:	11543923
stop:	11549006
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g15860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G59600	AT	Annotation by Michelle Graham. TAIR10: RNA polymerase Rpb8 \| chr3:22016629-22017923 FORWARD LENGTH=146	SoyBase	E_val: 4.00E-38	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005665	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase II, core complex	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
KOG3400	KOG	RNA polymerase subunit 8	JGI		ISS
PTHR10917	Panther	DNA-DIRECTED RNA POLYMERASE SUBUNIT RPB8	JGI		ISS
PF03870	PFAM	RNA polymerase Rpb8	JGI		ISS
UniRef100_G7JKJ0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerases I, II, and III subunit RPABC3 n=1 Tax=Medicago truncatula RepID=G7JKJ0_MEDTR	SoyBase	E_val: 2.00E-67	ISS
UniRef100_I1KTI0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTI0_SOYBN	SoyBase	E_val: 3.00E-112	ISS

Expression Patterns of Glyma08g15860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g15860

Paralog	Evidence	Comments
Glyma15g42430	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g15860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g149500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g15860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g15860

Limit To All Plant Sequences

>Glyma08g15860.1   sequence type=CDS   gene model=Glyma08g15860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGAACTTCTTTTTGATGACATTTTCAAGGTCGAGAAGGTAGACCCTGATGGTAAAAAGTATGACAAGGTTTCTCGGATTGTGGCACGGAGTGAGAAGTGTGACATGAACATGCTTCTAGATGTAAATACCGAGATTTATCCAATGGGGGAAAAAGAAAGATTCTTGATGGCTTTGTCTCCTTCACTTGTTTTGAATACTAAGGATGGTTCAGTGTCAATTCAAGACAAGTTTGAATACATCATGCACGGGAGGTTATATAACATTACGAAACCTCAGCTTGAAAAGAAAGAAAAGAAAGAGAAACGTTCAGAATCTCAGCCTGAAGAGAATGAGGAATGTTCAAAACCTCAGCTTGAAGTGGAGGTATATGCATCGTTTGGTGGGCTTCAGTTGATGCTGAAAGGACATGCTTCCCACTGTGTTAAGTTTGCAGTCGATCAGAAGTTGTTTTTACTTATAAGGAAGGTTGAAAGTTGA

Predicted protein sequences of Glyma08g15860

Limit To All Plant Sequences

>Glyma08g15860.1   sequence type=predicted peptide   gene model=Glyma08g15860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSELLFDDIFKVEKVDPDGKKYDKVSRIVARSEKCDMNMLLDVNTEIYPMGEKERFLMALSPSLVLNTKDGSVSIQDKFEYIMHGRLYNITKPQLEKKEKKEKRSESQPEENEECSKPQLEVEVYASFGGLQLMLKGHASHCVKFAVDQKLFLLIRKVES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain