SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g15620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g15620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g15620

Feature Type:gene_model
Chromosome:Gm08
Start:11347800
stop:11348898
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18690AT Annotation by Michelle Graham. TAIR10: MAP kinase substrate 1 | chr3:6429755-6430423 REVERSE LENGTH=222 SoyBaseE_val: 1.00E-27ISS
GO:0009870GO-bp Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_G7LD80UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein MKS1 n=1 Tax=Medicago truncatula RepID=G7LD80_MEDTR SoyBaseE_val: 3.00E-89ISS
UniRef100_I1KTG3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTG3_SOYBN SoyBaseE_val: 3.00E-137ISS

LocusGene SymbolProtein Name
VQ35 VQ motif containing protein gene 35

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15620 not represented in the dataset

Glyma08g15620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g32350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g147600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15620.1   sequence type=CDS   gene model=Glyma08g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCCGCCGGAATTTCCCTCCGGCAGCTGCGGAACATCATCGCCGCCAGGAAAGAAAGAGCTCCAGCTCCAAGGTACACGCCCGCCGCCTCTCAGAGTCAGCAAAGACTCCCACAAGATCCGCAAACCGCCGCTTCCCCCCACCGCGCACCAACCGGCGGCGCTGCCGGAGCACCGGAAGCCGGTGATCATCTACGCCGTGTCTCCGAAAGTCCTCCACGTTCCCGCCGGTGACTTCATGAACGTCGTCCAGCGCCTCACCGGACCCTCCTCCGGCGACGTATCGCCAGCGGCGAGACTCGCGTCGATCGAGAGAACGAGCCCGTCGGAGAGGGAGAAAGTTCACAGCGAAGACAACGACGTGAAGTTGATGTTAGAAGGAGTGGAAGTGGGTCAATTCCCCGGAATATTGTCGCCGGCGACGTTGCCTCCGATATCACCAGGGTTTTTCTCGGAACCGCAAACGACGTCATTTTGGAATGACTTGAGCCCGTTTTGGTCAACGAACAGCTTCGTGGCGAGTCCGTCGGGGTTACTTTCCGGCGCTTTGGTTTCTCCGCTGCCGTCGCCGGACATCTTTAATCTCTTCGACTAA

>Glyma08g15620.1   sequence type=predicted peptide   gene model=Glyma08g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPPEFPSGSCGTSSPPGKKELQLQGTRPPPLRVSKDSHKIRKPPLPPTAHQPAALPEHRKPVIIYAVSPKVLHVPAGDFMNVVQRLTGPSSGDVSPAARLASIERTSPSEREKVHSEDNDVKLMLEGVEVGQFPGILSPATLPPISPGFFSEPQTTSFWNDLSPFWSTNSFVASPSGLLSGALVSPLPSPDIFNLFD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo