SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g15480

Feature Type:gene_model
Chromosome:Gm08
Start:11234938
stop:11238375
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g15480
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09810AT Annotation by Michelle Graham. TAIR10: actin 7 | chr5:3052809-3054220 FORWARD LENGTH=377 SoyBaseE_val: 0ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010053GO-bp Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005856GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
KOG0676 KOG Actin and related proteins JGI ISS
PTHR11937Panther ACTIN JGI ISS
PTHR11937:SF77Panther ACTIN JGI ISS
PF00022PFAM Actin JGI ISS
UniRef100_I1K4W1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4W1_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9SLQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin isoform B n=2 Tax=Fabaceae RepID=Q9SLQ6_MIMPU SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g15480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g15480
ParalogEvidenceComments
Glyma05g32220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g15480 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g146500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g15480
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g15480
>Glyma08g15480.1   sequence type=CDS   gene model=Glyma08g15480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGATGCCGAGGATATTCAACCCCTTGTTTGCGACAATGGAACTGGAATGGTCAAGGCAGGATTTGCTGGTGACGATGCTCCTAGGGCTGTCTTTCCCAGTATTGTTGGCCGACCTCGACATACTGGTGTTATGGTTGGGATGGGTCAAAAGGATGCCTATGTTGGTGATGAAGCCCAATCCAAAAGAGGTATTCTTACTCTCAAGTATCCCATTGAGCATGGTATAGTCAGCAACTGGGATGACATGGAAAAGATCTGGCATCACACATTTTATAATGAACTTCGTGTTGCTCCCGAGGAGCACCCAGTGCTTCTCACTGAGGCCCCCCTCAACCCAAAGGCCAACAGAGAAAAGATGACCCAAATCATGTTTGAGACCTTCAATGTGCCTGCCATGTATGTGGCCATCCAGGCTGTTCTCTCCTTGTATGCAAGTGGTCGCACAACTGGTATTGTATTGGACTCTGGTGATGGTGTGAGTCACACTGTACCAATCTATGAGGGGTATGCACTCCCCCATGCCATCCTTCGTTTGGATCTCGCTGGTCGTGATCTAACTGATCATTTGATGAAGATCCTCACTGAGAGAGGATACATGTTCACCACCTCTGCTGAGCGAGAAATTGTCCGTGACATGAAGGAAAAACTTGCATATGTTGCCCTAGATTATGAGCAAGAACTCGAGACTGCAAAAAGCAGTTCATCAGTTGAGAAAAGCTATGAGCTTCCTGATGGACAAGTTATCACAATTGGGGCAGAGAGATTCCGTTGCCCAGAAGTTCTTTTCCAGCCATCTATGATTGGAATGGAAGCTGCTGGAATTCATGAGACCACCTACAATTCTATCATGAAGTGTGATGTGGATATCAGAAAGGATCTATATGGCAACATTGTTCTTAGTGGTGGCTCAACTATGTTTCCTGGTATTGCAGACCGTATGAGCAAGGAGATCACTGCTCTTGCTCCTAGCAGCATGAAGATTAAGGTTGTAGCTCCACCAGAAAGAAAATATAGTGTCTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCTTCCAGCAGATGTGGATTTCTAAAGGTGAATATGATGAGTCTGGCCCATCCATTGTCCACAGGAAGTGCTTCTAA
Predicted protein sequences of Glyma08g15480
>Glyma08g15480.1   sequence type=predicted peptide   gene model=Glyma08g15480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo