SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g15291

Feature Type:gene_model
Chromosome:Gm08
Start:11084584
stop:11087249
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65090AT Annotation by Michelle Graham. TAIR10: DNAse I-like superfamily protein | chr5:26004282-26006656 FORWARD LENGTH=529 SoyBaseE_val: 1.00E-15ISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010053GO-bp Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation SoyBaseN/AISS
GO:0032957GO-bp Annotation by Michelle Graham. GO Biological Process: inositol trisphosphate metabolic process SoyBaseN/AISS
GO:0046854GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol phosphorylation SoyBaseN/AISS
GO:0046855GO-bp Annotation by Michelle Graham. GO Biological Process: inositol phosphate dephosphorylation SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
UniRef100_D3YBG4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bristled-like protein n=1 Tax=Trifolium repens RepID=D3YBG4_TRIRP SoyBaseE_val: 3.00E-52ISS
UniRef100_UPI0002337F65UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337F65 related cluster n=1 Tax=unknown RepID=UPI0002337F65 SoyBaseE_val: 8.00E-102ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15291 not represented in the dataset

Glyma08g15291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g144500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15291.1   sequence type=CDS   gene model=Glyma08g15291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCGTTTACGGGTGCACGTTCCAAAGCAAATGCTAAGTCTGAAATGATCAAAGCTAACGAGATTAACCTCTGCCCCATCAACACAAGTACCATTACATCAACCTCGCCAGATACAAGTGCCAAGAATGAGAAGAAAAAGAAGTCTATCCTTCCAAAGATTTTCGGATCAAAGCGAAATGGGAGAGGTTCAGACGAAGAGACACTCAAATCATCAAGTGCAGAAGAAGGAGATGGAGTTACTCTTGATTTGGAGAATAAGATTGAGACGAGAAGAAAAGCATTTTTGGAAGCGGCCCCCATCATGAGAAAAAGTTTCTCAGAAAGGGAGACTAGTCCTGGGATCGAAGGCCTAAATTTGTCCAATTTTGAACGGCCTATGATGACTATGGAAACTGAACTTCTCAGGATCTTTGTTGCAGCGTGGAATGTGGGAGTCACCAAGTTATGA

>Glyma08g15291.1   sequence type=predicted peptide   gene model=Glyma08g15291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSFTGARSKANAKSEMIKANEINLCPINTSTITSTSPDTSAKNEKKKKSILPKIFGSKRNGRGSDEETLKSSSAEEGDGVTLDLENKIETRRKAFLEAAPIMRKSFSERETSPGIEGLNLSNFERPMMTMETELLRIFVAAWNVGVTKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo