SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g15280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g15280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g15280

Feature Type:gene_model
Chromosome:Gm08
Start:11082252
stop:11083891
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G22170AT Annotation by Michelle Graham. TAIR10: Phosphoglycerate mutase family protein | chr1:7826603-7828055 FORWARD LENGTH=334 SoyBaseE_val: 2.00E-93ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016868GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity, phosphotransferases SoyBaseN/AISS
PTHR11931Panther PHOSPHOGLYCERATE MUTASE JGI ISS
PF00300PFAM Phosphoglycerate mutase family JGI ISS
UniRef100_B9RJG7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglycerate mutase, putative n=1 Tax=Ricinus communis RepID=B9RJG7_RICCO SoyBaseE_val: 1.00E-90ISS
UniRef100_I1KTC8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KTC8_SOYBN SoyBaseE_val: 6.00E-161ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15280 not represented in the dataset

Glyma08g15280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g144400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15280.1   sequence type=CDS   gene model=Glyma08g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACCATCGATACTGATTTCTTGACCAAGAAGAAGAAGCAAGTTTCGGTGCAACTTCCGAGTTTGACATCACCTGTCTCCACTGTGAGATTTGAGTTTGGCAATTTCGTTGCACGACAAGCCCTGCTTCACGAAGAGTATTGGGTAAGTTTCGTTTCTTCTTTTCTTCTATCCGAGGCTGAGAGTGCTTTGATATTGGTTCGTCATGGGGAGTCTTTGTGGAATGAGAAGAACTTGTTCTCGGGATGTTGCAGTGTACCTTTGACCAACAGAGGTGTAGAGGAAGCTATTGAAGCTGGTCAGAGGATTAGCTATATACCCATTGATATGATCTTTACGTCCGCACTCATTCGTGCACAGATGACCGCTCTGCTTGCAATGACTCGGCACTCCCAGAAGAAGGTTCCTATTATCATCCATGATGAGAGTGAACAGGCAACAACTTGGACTCAAGTTTACAGTGAAAAAACCACCAAGCAATCTATTCCAGTTATTACAGCTTGGCAGTTGAATGAAAGAATGTATGGGGAGTTACAGGGTCTTAATAAGCAGGAGACTGCAGAAAGATACGGAAAGGAGAAGGTGCATGAATGGTGTCGGAGTTTTGACATTCCTCTTCCCAAGGGTGAGAGCCTGGAAGTGTGTTTTCAGAGAGCTGTT

>Glyma08g15280.1   sequence type=predicted peptide   gene model=Glyma08g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TIDTDFLTKKKKQVSVQLPSLTSPVSTVRFEFGNFVARQALLHEEYWVSFVSSFLLSEAESALILVRHGESLWNEKNLFSGCCSVPLTNRGVEEAIEAGQRISYIPIDMIFTSALIRAQMTALLAMTRHSQKKVPIIIHDESEQATTWTQVYSEKTTKQSIPVITAWQLNERMYGELQGLNKQETAERYGKEKVHEWCRSFDIPLPKGESLEVCFQRAV







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo