SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g15260

Feature Type:gene_model
Chromosome:Gm08
Start:11062466
stop:11065170
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g15260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G20580AT Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein | chr1:7128979-7130371 FORWARD LENGTH=131 SoyBaseE_val: 3.00E-71ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005732GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3172 KOG Small nuclear ribonucleoprotein Sm D3 JGI ISS
PTHR23338Panther SMALL NUCLEAR RIBONUCLEOPROTEIN SM JGI ISS
PF01423PFAM LSM domain JGI ISS
UniRef100_C6SWW8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWW8_SOYBN SoyBaseE_val: 2.00E-90ISS
UniRef100_G7LBD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein Sm D3 n=1 Tax=Medicago truncatula RepID=G7LBD3_MEDTR SoyBaseE_val: 6.00E-89ISS

Expression Patterns of Glyma08g15260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g15260
ParalogEvidenceComments
Glyma05g31950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g15260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g143900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g15260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g15260
>Glyma08g15260.1   sequence type=CDS   gene model=Glyma08g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCAGGAGTTTGGGAATTCCGGTGAAGCTGCTCCACGAGGCTTCGGGGCACGTGGTGACGGTGGAGCTCAAGAGCGGAGAACTCTACAGAGGAAGCATGATCGAGTGCGAGGACAACTGGAACTGTCAACTCGAGAGCATCACCTACACTGCCAAGGATGGCAAAACATCGCAACTTGAGCATGTGTTTATTCGAGGCAGCAAAGTCAGGTTTATGGTCATCCCTGACATGCTGAAGAATGCTCCTATGTTTAAGCGTTTGGATGCAAGAATCAAGGGTAAGGGTGCATCACTTGGTGTTGGTAGGGGCAGAGCAGTTGCAATGCGAGCAAAGGCTCAAGCTGCTGGGCGTGGAGCTGCGCCTGGAAGGGGTGTACCACCAGTGCGGAGGTGA
Predicted protein sequences of Glyma08g15260
>Glyma08g15260.1   sequence type=predicted peptide   gene model=Glyma08g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRSLGIPVKLLHEASGHVVTVELKSGELYRGSMIECEDNWNCQLESITYTAKDGKTSQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKGASLGVGRGRAVAMRAKAQAAGRGAAPGRGVPPVRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo