SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g15250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g15250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g15250

Feature Type:gene_model
Chromosome:Gm08
Start:11053202
stop:11058521
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39390AT Annotation by Michelle Graham. TAIR10: nucleotide sugar transporter-KT 1 | chr4:18316278-18317854 FORWARD LENGTH=337 SoyBaseE_val: 0ISS
GO:0006863GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport SoyBaseN/AISS
GO:0015780GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide-sugar transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0000139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005338GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide-sugar transmembrane transporter activity SoyBaseN/AISS
KOG1441 KOG Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter JGI ISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
PF03151PFAM Triose-phosphate Transporter family JGI ISS
UniRef100_G7LBD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Membrane protein, putative n=1 Tax=Medicago truncatula RepID=G7LBD2_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1K4T3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4T3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15250 not represented in the dataset

Glyma08g15250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g31940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g143800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15250.1   sequence type=CDS   gene model=Glyma08g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCAGCAACCAAGGGCGATAGGAAGACTGCACTTGATGTGGCATCATGGATGTTCAATATAGTCACATCTGTCGGAATAATCCTTGTGAATAAAGCCCTCATGGCTACATATGGTTTCAGCTTTGCTACAACGTTAACTGGTCTGCATTTTGCCACAACAACCTTGCTGACAGTCTTTCTTAAGTGGCTGGGATATATCCAAACCTCCCACCTTCCCTTACCTGATCTTATCAAATTTGTCTTATTTGCAAATTTCTCTATTGTCGGCATGAATGTGAGTTTGATGTGGAACTCTGTCGGTTTCTATCAGATTGCTAAGCTGAGTATGATTCCAGTATCTTGTTTCCTGGAAGTTATCTTGGACAATGTGCGATATTCAAGGGACACAAAACTTAGCATTTCTCTAGTTCTCCTTGGCGTTGCTGTATGTACAGTCACTGATGTGAGTGTCAATGCTAAGGGTTTTATAGCTGCTGCAGTGGCAGTTTGGAGCACCTCACTACAGCAGTATTATGTGCATTTTCTTCAGAGGAAGTATTCTCTTGGATCGTTTAACTTGTTGGGCCACACTGCACCAGTACAGGCAGCAAGTTTACTACTAGTAGGTCCCTTTTTGGACTATTGGCTGACAAAAAAACGAGTTGACGCCTACAACTATGGTTTCACATCCACTTTGTTCATCATTATCTCCTGCACCATCGCAGTAGGGACAAACCTCAGCCAGTTCATCTGCATTGGCAGGTTCACAGCTGTATCTTTCCAAGTCCTTGGACACATGAAGACTATTCTGGTACTGGCCTTAGGTTTCGTTTTCTTCAGAAAAGAAGGTGTCAATTTACAAGTGATTCTGGGCATGACCATTGCAATAGCGGGAATGATATGGTATGGCAATGCATCTTCTAAGCCAGGAGGGAAGGAACGTCTTAGCTTACCCCTTAACCATACCCCCAAGACACAAGAGTATAATGTACTACCAGTATCCTCTGAAATGGATCAAGAAATATAG

>Glyma08g15250.1   sequence type=predicted peptide   gene model=Glyma08g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSATKGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTVFLKWLGYIQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLGHTAPVQAASLLLVGPFLDYWLTKKRVDAYNYGFTSTLFIIISCTIAVGTNLSQFICIGRFTAVSFQVLGHMKTILVLALGFVFFRKEGVNLQVILGMTIAIAGMIWYGNASSKPGGKERLSLPLNHTPKTQEYNVLPVSSEMDQEI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo