SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g15080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g15080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g15080

Feature Type:gene_model
Chromosome:Gm08
Start:10942911
stop:10945563
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G09720AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog G3A | chr4:6133101-6134959 FORWARD LENGTH=206 SoyBaseE_val: 4.00E-114ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0394 KOG Ras-related GTPase JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF260Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_I1K4R8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4R8_SOYBN SoyBaseE_val: 9.00E-152ISS
UniRef100_Q40211UniRef Annotation by Michelle Graham. Most informative UniRef hit: RAB7A n=1 Tax=Lotus japonicus RepID=Q40211_LOTJA SoyBaseE_val: 5.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g15080 not represented in the dataset

Glyma08g15080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g31810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g142600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g15080.2   sequence type=CDS   gene model=Glyma08g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATTTCACAGAGAAAGAGAACTTTGCTAAAGATCATTGTTCTTGGTGATAGTGGGGTGGGAAAAACTTCTTTGATGAACCAATATGTTTATAGAAAATTCAGCCAGCAGTATAAAGCTACAATTGGGGCTGATTTTGTTACGAAGGAAATACAAGTTGATGATAAACTCGTAACATTGCAGATTTGGGATACAGCAGGGCAAGAAAGGTTCCATAGTCTTGGGGCTGCATTTTATAGAGGGGCAGATTGCTGTGTTCTGGTATATGATGTAAACATACACAAAACATTTGATACACTAAACAATTGGCATGATGAGTTTCTTAAGCAGGGAGATATGAACGACCCTGAAGCATTTCCCTTTGTATTACTTGGGAACAAGGTTGACGTAGACGGTGGAAACAGTAGAAGGGTCACTGAGAAAAAAGCTAGAGACTGGTGTGCTTCCCGGGGAAACATACCATACTTTGAGACCTCTGCGAAAGAGGGCTACAACGTTGAAGAGGCTTTTTCATGTGTTGCCAAAATTGCACTAGAAAATGAACATGATCAAGACATTTATTTTCGAGGAATCTCTGAAGCAGTTTCAGAAGCAGAACAACGAAGTGGTTGTGCATGCTGA

>Glyma08g15080.2   sequence type=predicted peptide   gene model=Glyma08g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDISQRKRTLLKIIVLGDSGVGKTSLMNQYVYRKFSQQYKATIGADFVTKEIQVDDKLVTLQIWDTAGQERFHSLGAAFYRGADCCVLVYDVNIHKTFDTLNNWHDEFLKQGDMNDPEAFPFVLLGNKVDVDGGNSRRVTEKKARDWCASRGNIPYFETSAKEGYNVEEAFSCVAKIALENEHDQDIYFRGISEAVSEAEQRSGCAC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo