|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G50870 | AT | Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr3:18911112-18912369 FORWARD LENGTH=295 | SoyBase | E_val: 2.00E-17 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0048446 | GO-bp | Annotation by Michelle Graham. GO Biological Process: petal morphogenesis | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0043565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding | SoyBase | N/A | ISS |
| PF00320 | PFAM | GATA zinc finger | JGI | ISS | |
| UniRef100_G7KDL1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GATA transcription factor n=1 Tax=Medicago truncatula RepID=G7KDL1_MEDTR | SoyBase | E_val: 3.00E-27 | ISS |
| UniRef100_I1LHS9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LHS9_SOYBN | SoyBase | E_val: 2.00E-47 | ISS |
|
Glyma08g15061 not represented in the dataset |
Glyma08g15061 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g142500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g15061.1 sequence type=CDS gene model=Glyma08g15061 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGGTATGTTTCACAGCCAAACCACCAGCTCCTTCGCCACGTTTTTCTCCATGCCCAACCACAAACCACCACCCTACATGATTCCGACAACATTTATGACTATTCTTCCTTCACTCCCTCTTCCTTTTCTTCCGTTGACTGCAACCTCTCCCTCGGTACCCCTTCCACCTGCGTCTCCGAAGACGAAGAAAAACGAAGCCGCCACGAATGCCATTCCGTCTCTAACTTCTGCTGGGACTTACTACAATCCAAACACAACAACCCTCAATCCCATTCCAAGTCCTCCGGAACCACCAACACCACCGACCCTCTCCTCGCTCGCCGCTGCGCCAATTGTGATACCACTTCTACTCCTCTCTGGAGAAATGCCCCCGTGGCCCTAAGGTACGTAAATAACTACAATATTTAG
>Glyma08g15061.1 sequence type=predicted peptide gene model=Glyma08g15061 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MWYVSQPNHQLLRHVFLHAQPQTTTLHDSDNIYDYSSFTPSSFSSVDCNLSLGTPSTCVSEDEEKRSRHECHSVSNFCWDLLQSKHNNPQSHSKSSGTTNTTDPLLARRCANCDTTSTPLWRNAPVALRYVNNYNI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||