SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g14995

Feature Type:gene_model
Chromosome:Gm08
Start:10909509
stop:10911660
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g14995
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74060AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family protein | chr1:27850033-27851299 REVERSE LENGTH=233 SoyBaseE_val: 2.00E-118ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1694 KOG 60s ribosomal protein L6 JGI ISS
PTHR10715Panther 60S RIBOSOMAL PROTEIN L6 JGI ISS
PF01159PFAM Ribosomal protein L6e JGI ISS
PF03868PFAM Ribosomal protein L6, N-terminal domain JGI ISS
UniRef100_B7FH28UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L6 n=1 Tax=Medicago truncatula RepID=B7FH28_MEDTR SoyBaseE_val: 1.00E-141ISS
UniRef100_I1KT98UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KT98_SOYBN SoyBaseE_val: 3.00E-164ISS

Expression Patterns of Glyma08g14995
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g14995 not represented in the dataset
Glyma08g14995 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g14995
ParalogEvidenceComments
Glyma05g31760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g14995 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g141700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g14995
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g14995
>Glyma08g14995.1   sequence type=CDS   gene model=Glyma08g14995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCCGAAGATAACACGCAAGGTCAGCAGAAACCCCGAATTGATAAGGGGAATCGGAAAGTACTCGAGGTCGCAGATGTACCACAAGAGGGGCATTTGGGCTATCAAGGCCAAAAACGGTGGCGTTTTACCTCGCCACGACCCCAAACCCAAACCTGAAACTCCCACTGAAAAACCACCCAAATTTTACCCCGCTGATGATGTCAAGAAACCCCTTGTCAACAAGCACAAACCCAAACCAGCTAAGCTCAGGGCTAGCATTACCCCCGGAACAGTGTTGATTCTTCTTGCTGGTAGATTTAAGGGAAAGAGGGTAGTGTTTTTGAAGCAGCTACCTTCTGGGTTGCTTCTTGTAACAGGTCCTTTCAAGGTTAATGGAGTTCCTTTGAGACGTGTGAATCAGGCCTATGTTATTGGCACATCAACCAAAGTAGATGTCTCTGCTGTTAATGTCAACAACTTTGATGACAAATACTTTGCGAAGGAAGCCCAGAGGAAGAAGAAGAAGGGAGAAGGGGAGTTCTTTGAGGCAGAGAAGGAGGAAAAGAGCGTGTTACCCCAGCAGAAGAAAGATGACCAGAAAACAGTGGATGCTGCATTGTTAAAAGCCATTGAGAGTGTGCCAGACTTGAAGTCTTATTTGGGTGCCAGGTTTTCTCTAAAGGCTGGCGTGAAACCTCATGAGCTAGTCTTCTAG
Predicted protein sequences of Glyma08g14995
>Glyma08g14995.1   sequence type=predicted peptide   gene model=Glyma08g14995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKITRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPTEKPPKFYPADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPLRRVNQAYVIGTSTKVDVSAVNVNNFDDKYFAKEAQRKKKKGEGEFFEAEKEEKSVLPQQKKDDQKTVDAALLKAIESVPDLKSYLGARFSLKAGVKPHELVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo