Glyma08g14550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g14550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g14550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g14550

Feature Type:	gene_model
Chromosome:	Gm08
Start:	10560487
stop:	10561616
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g14550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G22170	AT	Annotation by Michelle Graham. TAIR10: Lipase/lipooxygenase, PLAT/LH2 family protein \| chr2:9427010-9427742 REVERSE LENGTH=183	SoyBase	E_val: 1.00E-68	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR24748	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24748:SF34	Panther		JGI		ISS
PF01477	PFAM	PLAT/LH2 domain	JGI		ISS
UniRef100_G7J3U5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Elicitor-inducible protein EIG-J7 n=1 Tax=Medicago truncatula RepID=G7J3U5_MEDTR	SoyBase	E_val: 2.00E-72	ISS
UniRef100_I1KT36	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KT36_SOYBN	SoyBase	E_val: 1.00E-135	ISS

Expression Patterns of Glyma08g14550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g14550 not represented in the dataset	Glyma08g14550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g14550

Paralog	Evidence	Comments
Glyma05g31310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g14550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g137000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g14550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g14550

Limit To All Plant Sequences

>Glyma08g14550.1   sequence type=CDS   gene model=Glyma08g14550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCTGCAACACTGTCTCTGTCTCTCCTCCTCCTGTTCTCACTCAGCATCGCCGTAACCGTTAGATCGAGCGACTACGACTACGATTGTGTGTACACTGCATACGTTAGAACCGGTTCGGTGTTGAAGGGCGGAACGGACTCTAAGATCGGGCTGAAGCTGTACGACAAGTACGGCTACTACATCTACATTAAAAACCTCGAAGCATGGGGCGGCTTGATGGGCAAGGGCTACGACTACTTCGAGCGCGGCAACCTCGACATCTTCAGCGGAAGGGGACCCTGTCTTGACGGACCCGTCTGTGCCGTTAACGTTACTTCTGACGGATCGGGTTCTCACCACGGCTGGTACCTTAACTACGTCCAGGTCACCTCCACTGGGCCCCACCTTTCCTGCGCTCAGGATCAGTACGAGGTGGAGCAGTGGCTCGCTCTCGACACTTCGCCTTACCAGCTTTGGGCCGTTAGGAACCACTGCCGCTACAGTTTGGACCGGGCCCAGCCCGTTTCGGAGCGCCCCGGATCCGGATCCGGATCTGCGTTCTCTATTTTGAATGCACGAGCCTGA

Predicted protein sequences of Glyma08g14550

Limit To All Plant Sequences

>Glyma08g14550.1   sequence type=predicted peptide   gene model=Glyma08g14550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPATLSLSLLLLFSLSIAVTVRSSDYDYDCVYTAYVRTGSVLKGGTDSKIGLKLYDKYGYYIYIKNLEAWGGLMGKGYDYFERGNLDIFSGRGPCLDGPVCAVNVTSDGSGSHHGWYLNYVQVTSTGPHLSCAQDQYEVEQWLALDTSPYQLWAVRNHCRYSLDRAQPVSERPGSGSGSAFSILNARA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain