SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g14420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g14420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g14420

Feature Type:gene_model
Chromosome:Gm08
Start:10475118
stop:10476092
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39880AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L23/L15e family protein | chr4:18504601-18505137 FORWARD LENGTH=178 SoyBaseE_val: 3.00E-35ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG4089 KOG Predicted mitochondrial ribosomal protein L23 JGI ISS
PTHR12059Panther RIBOSOMAL PROTEIN L23-RELATED JGI ISS
PTHR12059:SF5Panther SUBFAMILY NOT NAMED JGI ISS
PF00276PFAM Ribosomal protein L23 JGI ISS
UniRef100_B9SZ40UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9SZ40_RICCO SoyBaseE_val: 3.00E-35ISS
UniRef100_UPI000233872EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233872E related cluster n=1 Tax=unknown RepID=UPI000233872E SoyBaseE_val: 1.00E-75ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g14420 not represented in the dataset

Glyma08g14420 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g31235 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g135700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g14420.2   sequence type=CDS   gene model=Glyma08g14420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACACATCACAAACCTTCCCATGACGCCACTGATGCCGGCCAGCACTTCCTCAAACAACATCAAAGAAATCGCGTTTAAGACTGCTCCTTCAGCTTCCAAGGTCGAAATCAAGCGTTTCCTCGAAACCTTCTACGGGTTCGAGGTCGAAAAGGTGCGAACTCTGAACATGAAGGGCAAGAAGAAGCGTTACGCGGGATCGTTGGTAGCAAAACCCGATTACAAGAAGGCCTACGTCACCCTCAAGAAACCACTTTCCTTCTCTCAGAACCCTTACCCCTTTGGTTCCACCGTAGAAGACAAGAAGAAAGAGAATATGTTGACCACTACTCACTACTAA

>Glyma08g14420.2   sequence type=predicted peptide   gene model=Glyma08g14420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHITNLPMTPLMPASTSSNNIKEIAFKTAPSASKVEIKRFLETFYGFEVEKVRTLNMKGKKKRYAGSLVAKPDYKKAYVTLKKPLSFSQNPYPFGSTVEDKKKENMLTTTHY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo