SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g14230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g14230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g14230

Feature Type:gene_model
Chromosome:Gm08
Start:10352328
stop:10356295
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65270AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A4A | chr5:26083437-26084550 FORWARD LENGTH=226 SoyBaseE_val: 4.00E-128ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0087 KOG GTPase Rab11/YPT3, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF213Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_Q08147UniRef Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein n=2 Tax=Papilionoideae RepID=Q08147_PEA SoyBaseE_val: 3.00E-138ISS
UniRef100_UPI0002338725UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338725 related cluster n=1 Tax=unknown RepID=UPI0002338725 SoyBaseE_val: 2.00E-150ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g14230 not represented in the dataset

Glyma08g14230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g31020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g133800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g14230.2   sequence type=CDS   gene model=Glyma08g14230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGTGCAGGAGGAGGGTATGGGGACGCGAACCAGAGGATAGACTACGTGTTCAAGGTGGTGCTGATAGGGGACTCGGCGGTGGGGAAGTCGCAGATACTAGCTCGGTTTGCGAGGAACGAGTTCAGCTTGGACTCCAAGTCCACCATCGGTGTTGAATTTCAGACAAGGACCTTGGTCATAGATCACAAGACCGTTAAGGCTCAGATCTGGGACACTGCTGGCCAAGAACGATACAGAGCAGTTACGAGTGCATACTACAGGGGTGCTGTGGGGGCAATGTTGGTTTATGACATCACTAAACGCCAAACCTTTGATCACATACCACGTTGGTTAGAAGAACTGCGCAACCATGCTGACAAGAACATAGTCATCATTCTTATAGGAAACAAATGTGATCTTGAGAGCCAGCGTGATGTACCCACCGAGGATGCAAAAGAATTTGCTGAGAAAGAAGGTTTATTTTTCTTAGAGACCTCAGCACTAGAAGCAACTAATGTTGAAACAGCCTTCATAACTGTCTTGACAGAAATATACAACATTGTCAACAAGAAGAACCTAACTGCTGATGAAAATCAGGGAAATGGGAACTCGGCATCTTTGTCTGGCCAGAAGATTATTGATATATATCACTTCATCAATAGTCATTGA

>Glyma08g14230.2   sequence type=predicted peptide   gene model=Glyma08g14230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGAGGGYGDANQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDLESQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKKNLTADENQGNGNSASLSGQKIIDIYHFINSH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo