Report for Sequence Feature Glyma08g13840
Feature Type: gene_model
Chromosome: Gm08
Start: 10096672
stop: 10097592
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g13840
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G67785 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 30 Blast hits to 30 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:25416100-25416984 REVERSE LENGTH=63
SoyBase E_val: 7.00E-27 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005747 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6SYT6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYT6_SOYBN
SoyBase E_val: 2.00E-37 ISS
Expression Patterns of Glyma08g13840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g13840
Paralog Evidence Comments
Glyma05g30643 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g13840 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g130200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g13840
Coding sequences of Glyma08g13840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g13840.1 sequence type=CDS gene model=Glyma08g13840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGAAAGTGGCGACGTACTTCGCGATGACGCTTGGAGCCTTCGTGTTCTGGCAGTCCATGGACAAACTCCATGTCTGGATCGCTCTTCGTCAAGACGAAAAGAAAGAGAGGTTGGAGAAGGAAGCGGAGATCAGAAGGGTTAGAGAAGAATTATTGCAGCAGCAGGCCAGTCAGAAGGATTCTCTTTCTTGA
Predicted protein sequences of Glyma08g13840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g13840.1 sequence type=predicted peptide gene model=Glyma08g13840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVKVATYFAMTLGAFVFWQSMDKLHVWIALRQDEKKERLEKEAEIRRVREELLQQQASQKDSLS*