SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g13551): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g13551): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g13551

Feature Type:gene_model
Chromosome:Gm08
Start:9916001
stop:9917686
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G36110AT Annotation by Michelle Graham. TAIR10: cytochrome P450, family 716, subfamily A, polypeptide 1 | chr5:14195377-14197613 FORWARD LENGTH=477 SoyBaseE_val: 1.00E-20ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR24286Panther FAMILY NOT NAMED JGI ISS
PTHR24286:SF25Panther JGI ISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_G7L9K3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Abscisic acid 8'-hydroxylase n=1 Tax=Medicago truncatula RepID=G7L9K3_MEDTR SoyBaseE_val: 1.00E-54ISS
UniRef100_I1KSS8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KSS8_SOYBN SoyBaseE_val: 3.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g13551 not represented in the dataset

Glyma08g13551 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g30420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g13551.1   sequence type=CDS   gene model=Glyma08g13551   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCAAAATGCCAGAAAGTTTGAGGACTTGTATTTTGGGATCCATTCTGTTCCTGTGAATTTTACAGGCTTTATATACCATAGGGCACTCAAGGCTGCAGCTGCAATAAGGAAAAAAATCCAATTTCTGATGCCAAGACTTGAAATAAGCAACATCATCATGGGGTTGATGAATTTCAGCCACATGCCAATAGCTATTACTCAAGCTTTCATGATCAAACACATTGGACAGAGGCCTGCTATCTACCAGAAAATCTTATCCGAGTATGCTGATATTAAAAAATCCAAAGGATCCAATGCAGCACTAGATTGGGACAGCAGACAGAAATTGAAATACACATGGGTTGTTGCACAAGAGACCATGAGACTCTACCCAACTGCACCAGGTGCATTGAGAGAGGCAATAACAGATATCACCTATGAAGGTTTTACTATTCCAAAGGGGTGGGAGGTACCTTGA

>Glyma08g13551.1   sequence type=predicted peptide   gene model=Glyma08g13551   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNQNARKFEDLYFGIHSVPVNFTGFIYHRALKAAAAIRKKIQFLMPRLEISNIIMGLMNFSHMPIAITQAFMIKHIGQRPAIYQKILSEYADIKKSKGSNAALDWDSRQKLKYTWVVAQETMRLYPTAPGALREAITDITYEGFTIPKGWEVP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo