Glyma08g13431 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g13431

Feature Type:	gene_model
Chromosome:	Gm08
Start:	9833160
stop:	9835104
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g13431

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G60990	AT	Annotation by Michelle Graham. TAIR10: Glycine cleavage T-protein family \| chr1:22462771-22465416 REVERSE LENGTH=432	SoyBase	E_val: 3.00E-22	ISS
GO:0016226	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004047	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminomethyltransferase activity	SoyBase	N/A	ISS
PF01571	PFAM	Aminomethyltransferase folate-binding domain	JGI		ISS
UniRef100_G7L8V3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aminomethyltransferase n=1 Tax=Medicago truncatula RepID=G7L8V3_MEDTR	SoyBase	E_val: 7.00E-29	ISS
UniRef100_UPI0002339266	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339266 related cluster n=1 Tax=unknown RepID=UPI0002339266	SoyBase	E_val: 3.00E-65	ISS

Expression Patterns of Glyma08g13431

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g13431 not represented in the dataset	Glyma08g13431 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g13431

Paralog	Evidence	Comments
Glyma05g30270	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g13431 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g127500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g13431

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g13431

Limit To All Plant Sequences

>Glyma08g13431.1   sequence type=CDS   gene model=Glyma08g13431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAGAAGAAGCTAATATCCAAATCAATTCGCGCTCAGTCCTCACCTTTCGACCTCTCTCCTCCTCCCATCGACCATGATTTCCTGGTTGATAAGCAGCCTGTAACTTTAGGGGTTGGAAACATCATTTCTGAAGATGGTTTTTCATTACTGATGTCTCCAGGAGCTGCTCCATCCATTTGGAAAGCTATTCTTTCTCAAGGAGCAATCCCAATGGGTTCTAATGCATGGAATAAACTACGGTTTATTCGAGGTTGTTACAAAGGACAGGAGACTATATCTAGGCTCATAACATGA

Predicted protein sequences of Glyma08g13431

Limit To All Plant Sequences

>Glyma08g13431.1   sequence type=predicted peptide   gene model=Glyma08g13431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKEKKLISKSIRAQSSPFDLSPPPIDHDFLVDKQPVTLGVGNIISEDGFSLLMSPGAAPSIWKAILSQGAIPMGSNAWNKLRFIRGCYKGQETISRLIT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain