Glyma08g12840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g12840

Feature Type:	gene_model
Chromosome:	Gm08
Start:	9393595
stop:	9396064
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g12840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G51960	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Complex 1 LYR protein (InterPro:IPR008011); Has 45 Blast hits to 45 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 45; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr5:21110716-21111116 FORWARD LENGTH=103	SoyBase	E_val: 2.00E-42	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_C6T1D6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1D6_SOYBN	SoyBase	E_val: 5.00E-75	ISS
UniRef100_Q2RAX8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=3 Tax=Oryza sativa Japonica Group RepID=Q2RAX8_ORYSJ	SoyBase	E_val: 1.00E-36	ISS

Expression Patterns of Glyma08g12840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g12840

Paralog	Evidence	Comments
Glyma05g29730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g12840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g121800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g12840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g12840

Limit To All Plant Sequences

>Glyma08g12840.1   sequence type=CDS   gene model=Glyma08g12840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGATCCGACGCCTTCCAAACAGCTAACATTTATCGCCTTCTTCTCAAGGCAGTCAAGAAACATATTGGGAAGGAAGAGAACAAGAGACATTTTATAGAATTTGTAACCTCAGAGTTCCGTAACAACCGAAATTTGTCTGACTGTGTGGCTATCCAACAGAAAATAAAGCTTGCTCGTGATTATACTTTTCTTCTTAACAGTGTACACCATCACAAGGATTTACTTTTTTCATACAATATTGCCGTGGATAGGTCAGATGAAGTAAAAAGGACTCTTGGAAAATCTGCTTCTAGTGTTGGTCTTCAGCTTCCCGAGGTTTATCAGCCATAA

Predicted protein sequences of Glyma08g12840

Limit To All Plant Sequences

>Glyma08g12840.1   sequence type=predicted peptide   gene model=Glyma08g12840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSDAFQTANIYRLLLKAVKKHIGKEENKRHFIEFVTSEFRNNRNLSDCVAIQQKIKLARDYTFLLNSVHHHKDLLFSYNIAVDRSDEVKRTLGKSASSVGLQLPEVYQP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain