SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g12450

Feature Type:gene_model
Chromosome:Gm08
Start:9134326
stop:9135812
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g12450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29270AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G40435.1); Has 98 Blast hits to 98 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 98; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:10230140-10231021 FORWARD LENGTH=155 SoyBaseE_val: 5.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7K7C1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH93 n=1 Tax=Medicago truncatula RepID=G7K7C1_MEDTR SoyBaseE_val: 1.00E-08ISS
UniRef100_I1KSG2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSG2_SOYBN SoyBaseE_val: 3.00E-117ISS

Expression Patterns of Glyma08g12450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g12450
ParalogEvidenceComments
Glyma05g29300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g12450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g118100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g12450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g12450
>Glyma08g12450.1   sequence type=CDS   gene model=Glyma08g12450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGCAGGGTGCAGAAAAGAATTTCGCTGCGCAGAAAACTTCACATTCTCCGAGTCCTTACCTACTCAAACTCTGCCAAGAGAACCTCCCTTGCCAAGAGTACCGTTCTACGCTTATACAAGCTAAAGCTCGCACTGGAAACTGTCAAAAGACAGTATGAAAACCTATTAGCCACCAGAAGAGAGTGCGTTAGGCTATTGAACCATGTCAAAGAGAGCAAGGATGTGAAAATAGAGAAGGTAGGGGCAGGAACTTTTATGGTGAGGGTCACATGTGAGAAAGGAGGTGACAATCTGGTGGCTATATTAAAGGCATTTGATGAGATGTGCCTGGATGTTCAGCAAGCGAGAGTTTCATGTGAAAATGGTTTTTTTCTGGAAGCCATTGCTGTGGCTGAGGACCAAACGCTGGATGTAAGAGATATCACTGAAGTGCTTCTAAAAGCAATTGGAAAGCAGAGTGGTGAAAAGGACTCGCAGATGTTTGACAAATGCTGTGATTCGTGA
Predicted protein sequences of Glyma08g12450
>Glyma08g12450.1   sequence type=predicted peptide   gene model=Glyma08g12450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACRVQKRISLRRKLHILRVLTYSNSAKRTSLAKSTVLRLYKLKLALETVKRQYENLLATRRECVRLLNHVKESKDVKIEKVGAGTFMVRVTCEKGGDNLVAILKAFDEMCLDVQQARVSCENGFFLEAIAVAEDQTLDVRDITEVLLKAIGKQSGEKDSQMFDKCCDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo