Report for Sequence Feature Glyma08g12440
Feature Type: gene_model
Chromosome: Gm08
Start: 9107665
stop: 9109954
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g12440
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G42760 AT
Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1685 (InterPro:IPR012881); Has 170 Blast hits to 164 proteins in 34 species: Archae - 0; Bacteria - 1; Metazoa - 26; Fungi - 10; Plants - 107; Viruses - 0; Other Eukaryotes - 26 (source: NCBI BLink). | chr2:17796382-17797185 REVERSE LENGTH=267
SoyBase E_val: 5.00E-33 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF07939 PFAM
Protein of unknown function (DUF1685)
JGI ISS
UniRef100_I1KSG1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSG1_SOYBN
SoyBase E_val: 6.00E-179 ISS
Expression Patterns of Glyma08g12440
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma08g12440
Paralog Evidence Comments
Glyma05g29280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g12440 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g118000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g12440
Coding sequences of Glyma08g12440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g12440.1 sequence type=CDS gene model=Glyma08g12440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATGCGGAGGCTGTCTTGAACCTCTTTGATTCTTGCTGGTTTGAGGTTAACATTTTAAGGAGAAATTCTAGTCCTCACACATCAATTACAAGTTATACAGAAAATTTAGATCATGTGTTAAAAGAAGAAAAAGAACCAAAGCTACCCTTGATCCGAACCAGCCACACCAGATCCATGAGTGACCAATTATCCATGACAACAACAAGCTTCAACCAAGATTCTCTTTCACCTGACTCAGTGCTTCTTCTCCATCCAAAGCTCCAAACCATTCTCTCAGGAAAAGAAGCCACTGACTCAGAACCTGATGAGAACCCAAGAACGCAGGTTAGGCCTCATCCTGAGGTGTTGTGTCCTAAGAAGAACAAAAAAATCTCAAGCAGTAGAACTAGGAAGAGGAGGGAGAGCAAGAGTTTGTCAGACCTTGAATTTGAGGAGCTTAAAGGGTTCATGGATCTGGGTTTTGTTTTCTCAGAGGAGGATAAAGACTCAAGCTTGGCTTCAATTATTCCTGGGTTGCAAAGGCTACGGAAGAAGGAAGAGGAAGAAGAAGAAAATGAAGATTGTGATGAGATAAGTGTTCCAAGGCCTTACCTTTCTGAAGCATGGGAGGTTCAGGAATATGATAGGAGAAAAAAAGAGAACTCTTTGGTGAATTGGAAAATGCCTGCTATCAACAATGAAACTGACATGAAAGAAAGTCTTAGATGGTGGGCTCATACTGTTGCTTCCACTGTCAGATGA
Predicted protein sequences of Glyma08g12440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g12440.1 sequence type=predicted peptide gene model=Glyma08g12440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDAEAVLNLFDSCWFEVNILRRNSSPHTSITSYTENLDHVLKEEKEPKLPLIRTSHTRSMSDQLSMTTTSFNQDSLSPDSVLLLHPKLQTILSGKEATDSEPDENPRTQVRPHPEVLCPKKNKKISSSRTRKRRESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLRKKEEEEEENEDCDEISVPRPYLSEAWEVQEYDRRKKENSLVNWKMPAINNETDMKESLRWWAHTVASTVR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
