|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G25650 | AT | Annotation by Michelle Graham. TAIR10: ACD1-like | chr4:13081021-13083153 REVERSE LENGTH=559 | SoyBase | E_val: 3.00E-26 | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0010277 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chlorophyllide a oxygenase [overall] activity | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0051537 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding | SoyBase | N/A | ISS |
| PTHR21266 | Panther | IRON-SULFUR DOMAIN CONTAINING PROTEIN | JGI | ISS | |
| PTHR21266:SF3 | Panther | PHEOPHORBIDE A OXYGENASE | JGI | ISS | |
| UniRef100_G7LIM2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pheophorbide a oxygenase n=1 Tax=Medicago truncatula RepID=G7LIM2_MEDTR | SoyBase | E_val: 3.00E-37 | ISS |
| UniRef100_I1KSC2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSC2_SOYBN | SoyBase | E_val: 4.00E-41 | ISS |
|
Glyma08g12060 not represented in the dataset |
Glyma08g12060 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g12060.1 sequence type=CDS gene model=Glyma08g12060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATAACTTGGTTAAAGAAGTATGCAGGTGGTCAGGTTGATTGGAGAGGAAAATATAGTGGGGCTCTCCCTCCAACACCTCCAAGAGAACAGCTTATGGACAGGTACTGGTCCCATGTGGTGAATTGCAAGAGTTGCAATTCTCTTTATAAGAGCCTCAATGTTGTTGAAGTAATGCTGCAGATCACATCTGTTGCTTCAATTGGGGTTGTTGCCATCATGAAGCAT
>Glyma08g12060.1 sequence type=predicted peptide gene model=Glyma08g12060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ITWLKKYAGGQVDWRGKYSGALPPTPPREQLMDRYWSHVVNCKSCNSLYKSLNVVEVMLQITSVASIGVVAIMKH
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||