SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g12010

Feature Type:gene_model
Chromosome:Gm08
Start:8698292
stop:8699873
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g12010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30845AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 120 Blast hits to 120 proteins in 67 species: Archae - 0; Bacteria - 0; Metazoa - 35; Fungi - 37; Plants - 23; Viruses - 0; Other Eukaryotes - 25 (source: NCBI BLink). | chr1:10979856-10980427 FORWARD LENGTH=118 SoyBaseE_val: 6.00E-40ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_B6SQ79UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cell growth defect factor 2 n=1 Tax=Zea mays RepID=B6SQ79_MAIZE SoyBaseE_val: 3.00E-37ISS
UniRef100_I1KSB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSB6_SOYBN SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma08g12010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g12010
ParalogEvidenceComments
Glyma05g28860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g12010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g113800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g12010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g12010
>Glyma08g12010.1   sequence type=CDS   gene model=Glyma08g12010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGATCGAATCGGAGCATGGAGGGAGGGAAGAGAAAAGGGTACGCGTGGGCACTATCTGCTGGATTCAACGCCGCTCTTGCAGCCATTTCCGTTAAGCTCCCTCTTCACCAGTTTGTTAGGTATGGGATGGTGTTATTGTTCAATGTGACCATGTGGGCTTGTTATGTGAACAGCCTCAAAGCGCTCTCCTCTCTTCAGGCAACTGTCACCAATTTCGCCACCAATTTCATCTCTTCCGGTTTAGCCGGTTTCTTCTTCTTTCACGAATCACTCTCTTTCCAGTGGTTTGCAGGTGCCATACTTATAATAATTGGTGTAGTAATACTTAGCAACTCAAGTATTGAGAAGAAGGTTAGCACTGATTAG
Predicted protein sequences of Glyma08g12010
>Glyma08g12010.1   sequence type=predicted peptide   gene model=Glyma08g12010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSNRSMEGGKRKGYAWALSAGFNAALAAISVKLPLHQFVRYGMVLLFNVTMWACYVNSLKALSSLQATVTNFATNFISSGLAGFFFFHESLSFQWFAGAILIIIGVVILSNSSIEKKVSTD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo