Glyma08g11870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g11870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g11870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g11870

Feature Type:	gene_model
Chromosome:	Gm08
Start:	8629531
stop:	8630314
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g11870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G55265	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 \| chr1:20617326-20617853 FORWARD LENGTH=175	SoyBase	E_val: 2.00E-46	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
PF04398	PFAM	Protein of unknown function, DUF538	JGI		ISS
UniRef100_I1KSA4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KSA4_SOYBN	SoyBase	E_val: 7.00E-124	ISS
UniRef100_Q10EV9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10EV9_ORYSJ	SoyBase	E_val: 9.00E-31	ISS

Expression Patterns of Glyma08g11870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g11870 not represented in the dataset	Glyma08g11870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g11870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g112500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g11870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g11870

Limit To All Plant Sequences

>Glyma08g11870.1   sequence type=CDS   gene model=Glyma08g11870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCCTGATCCAATCCTTGACAGCTAGGAAGCGTCTGAGTCCGAGGGAAGACATGTTCCCACAAACCCTAATATTGTTCTCAGCACTCATAATCCTCTTCCATGGAGATCTCGTCTTAAGCACAACAGCACCAGATGATATCCACGATGTTCTCCCTCAGTACGGTTTCCCAAAGGGTCTTCTTCCCAACAACGCGGTCTCCTACACCCTCTCCCCCGACGATGGCTTCTTCACCGTCCAGCTCGATGCCCCCTGCTACGTCCACTGGGACGACCAATTAGTCTACTACCACAGCCAAATCAGTGGCACTCTCACCTACGGTTCCGTCTCGCACGTGTCGGGGATTCAGGCCCAGAAACTCTTCCTCTGGCTCCCTGTTACCGGAATTAAGGTCCACCAGGATTCCGGCATGTTAGAGTTCTTCGTTGGAGCTTTGTCCCAGACGCTACCCGCCAGCGACTTCCAGGATGTGCCTGGGTGCTCCCGCAGAGGATCGCTGCTCGCTACAAACCTCATTCTTCCTCTCTGA

Predicted protein sequences of Glyma08g11870

Limit To All Plant Sequences

>Glyma08g11870.1   sequence type=predicted peptide   gene model=Glyma08g11870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILIQSLTARKRLSPREDMFPQTLILFSALIILFHGDLVLSTTAPDDIHDVLPQYGFPKGLLPNNAVSYTLSPDDGFFTVQLDAPCYVHWDDQLVYYHSQISGTLTYGSVSHVSGIQAQKLFLWLPVTGIKVHQDSGMLEFFVGALSQTLPASDFQDVPGCSRRGSLLATNLILPL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain