SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g11840

Feature Type:gene_model
Chromosome:Gm08
Start:8618248
stop:8619945
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g11840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44290AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr2:18305418-18306202 REVERSE LENGTH=205 SoyBaseE_val: 8.00E-47ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_C6SVG8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVG8_SOYBN SoyBaseE_val: 8.00E-136ISS
UniRef100_G7LHX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein-like protein n=1 Tax=Medicago truncatula RepID=G7LHX9_MEDTR SoyBaseE_val: 7.00E-80ISS

Expression Patterns of Glyma08g11840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g11840
ParalogEvidenceComments
Glyma05g28720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g11840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g112300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g11840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g11840
>Glyma08g11840.1   sequence type=CDS   gene model=Glyma08g11840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCCAAAGGGGCAAAAAATCTAGCACTCTCTTCAGCCTTGTTGCTCCTTTTGGTCGGTTTTGCAACCTCAGACATCAATCAAGACAAAGCAGAATGTACGGATAAACTTCTTGGTCTAGCTGGTTGTCTTTCCTATGTTGGTGGCGAAGCCAAAGTCCCCACCATGGATTGTTGCTCTGGTATCAAAGAGGTTATTAACAAGAGCAAGAGGTGCCTCTGCATCCTCATCAAGGATCGTGATGATCCTAGTCTTGGCCTCAAGATCAACGTCACCCTTGCTTTAAACTTACCAGATGTTTGTGAAACACCCACTAATATAACTCAGTGTGTTGATCTTTTGCATTTGGCACCCAAGTCCCAGGAAGCTAAGGTGTTTGAGGGGTTTGAAAAAGCCTTGACCAACAAAACTAGTCCCTCCCCGGTCCTTAGTGCTAATAACACAACTGCAAAGGGAACAAGCACAAGCGCGAACAACAACAGCGGAGGTGGGTGGGGAAAGAGGTGGTTAGTGGCAGAGGTGGTGTGTGTGATTTTACCGATTGTTTTTATTTCCCATTTTTTCTTGTTCCTAGTTTGA
Predicted protein sequences of Glyma08g11840
>Glyma08g11840.1   sequence type=predicted peptide   gene model=Glyma08g11840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSKGAKNLALSSALLLLLVGFATSDINQDKAECTDKLLGLAGCLSYVGGEAKVPTMDCCSGIKEVINKSKRCLCILIKDRDDPSLGLKINVTLALNLPDVCETPTNITQCVDLLHLAPKSQEAKVFEGFEKALTNKTSPSPVLSANNTTAKGTSTSANNNSGGGWGKRWLVAEVVCVILPIVFISHFFLFLV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo