SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g11620

Feature Type:gene_model
Chromosome:Gm08
Start:8466646
stop:8469994
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13930AT Annotation by Michelle Graham. TAIR10: Chalcone and stilbene synthase family protein | chr5:4488762-4490035 FORWARD LENGTH=395 SoyBaseE_val: 0ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009629GO-bp Annotation by Michelle Graham. GO Biological Process: response to gravity SoyBaseN/AISS
GO:0009715GO-bp Annotation by Michelle Graham. GO Biological Process: chalcone biosynthetic process SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0031540GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016210GO-mf Annotation by Michelle Graham. GO Molecular Function: naringenin-chalcone synthase activity SoyBaseN/AISS
GO:0016746GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11877Panther HYDROXYMETHYLGLUTARYL-COA SYNTHASE JGI ISS
PTHR11877:SF9Panther GERANYL GERANYL DIPHOSPHATE SYNTHASE JGI ISS
PF00195PFAM Chalcone and stilbene synthases, N-terminal domain JGI ISS
PF02797PFAM Chalcone and stilbene synthases, C-terminal domain JGI ISS
UniRef100_P24826UniRef Annotation by Michelle Graham. Best UniRef hit: Chalcone synthase 1 n=5 Tax=Glycine max RepID=CHS1_SOYBN SoyBaseE_val: 0ISS
UniRef100_P24826UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chalcone synthase 1 n=5 Tax=Glycine max RepID=CHS1_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
CHS1 Chalcone synthase 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g109400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g11620.1   sequence type=CDS   gene model=Glyma08g11620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGTGTTGAAGAGATTCGTAAGGCGCAACGTGCAGAAGGCCCTGCCACTGTCATGGCTATTGGCACCGCCACTCCTCCCAACTGCGTGGATCAGAGTACCTATCCTGACTATTATTTCCGCATCACCAACAGCGAGCACATGACCGAGCTCAAAGAAAAATTCAAGCGCATGTGTGATAAGTCGATGATTAAGAAGCGATACATGTACTTAAACGAAGAGATCCTGAAAGAGAATCCGAGTGTTTGTGCTTACATGGCACCTTCGTTGGATGCAAGGCAAGACATGGTGGTTGTGGAGGTACCAAAGTTGGGAAAAGAGGCTGCAACTAAGGCAATCAAGGAATGGGGTCAACCCAAGTCCAAGATTACCCATCTCATCTTTTGCACCACTAGTGGTGTCGACATGCCTGGTGCTGATTATCAGCTCACTAAACTATTAGGCCTTCGCCCCTCCGTCAAGCGTTACATGATGTACCAACAAGGCTGCTTTGCCGGTGGCACGGTGCTTCGTTTGGCCAAAGACCTCGCTGAAAACAACAAGGGTGCTCGCGTGCTTGTCGTTTGTTCTGAGATCACCGCAGTCACATTTCGCGGCCCAACTGACACCCATCTTGATAGCCTTGTGGGTCAAGCCTTGTTTGGAGATGGTGCAGCCGCTGTCATTGTTGGATCAGACCCCTTACCAGTTGAAAAGCCTTTGTTTCAGCTTGTCTGGACTGCCCAGACAATCCTTCCAGACAGTGAAGGGGCTATTGATGGACACCTTCGCGAAGTTGGTCTCACTTTCCATCTCCTCAAGGATGTTCCTGGACTCATCTCCAAGAATATTGAGAAGGCCTTGGTTGAAGCCTTCCAACCCTTGGGAATCTCCGATTACAATTCTATCTTCTGGATTGCACACCCTGGTGGACCCGCAATTTTGGACCAAGTTGAGGCTAAGTTAGGCCTGAAGCCTGAAAAAATGGAAGCTACTAGACATGTGCTCAGCGAGTATGGTAACATGTCAAGTGCATGCGTGCTATTCATCTTGGATCAAATGAGGAAGAAATCAATAGAAAATGGACTTGGCACAACCGGTGAAGGTCTTGACTGGGGTGTGCTATTTGGTTTCGGCCCTGGACTCACCGTTGAGACTGTTGTGCTCCGCAGTGTCACTCTCTGA

>Glyma08g11620.1   sequence type=predicted peptide   gene model=Glyma08g11620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLPVEKPLFQLVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo