Glyma08g11250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g11250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g11250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g11250

Feature Type:	gene_model
Chromosome:	Gm08
Start:	8216699
stop:	8219296
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g11250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G47320	AT	Annotation by Michelle Graham. TAIR10: ribosomal protein S19 \| chr5:19203801-19204951 FORWARD LENGTH=212	SoyBase	E_val: 3.00E-30	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005763	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial small ribosomal subunit	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0015935	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0899	KOG	Mitochondrial/chloroplast ribosomal protein S19	JGI		ISS
PTHR11880	Panther	40S RIBOSOMAL PROTEIN S15	JGI		ISS
PTHR11880:SF1	Panther	40S RIBOSOMAL PROTEIN S15	JGI		ISS
PF00203	PFAM	Ribosomal protein S19	JGI		ISS
UniRef100_G7KH93	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S19 n=1 Tax=Medicago truncatula RepID=G7KH93_MEDTR	SoyBase	E_val: 3.00E-60	ISS
UniRef100_I1KS47	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KS47_SOYBN	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma08g11250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g11250 not represented in the dataset	Glyma08g11250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g11250

Paralog	Evidence	Comments
Glyma05g28270	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g11250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g106800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g11250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g11250

Limit To All Plant Sequences

>Glyma08g11250.1   sequence type=CDS   gene model=Glyma08g11250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGCCTACAATGATGCTTAGGGCTCTAACCAAGCAGTTTCTTGGAATTGTAGGCGATACAGCAAACACTGTTGCTAAGAAGCCACCCCCACCTCCTCCTCTGGTGTCACGCAAACCGGCGTTCATTGATGCATTCTTGTATAAGATGAAGAAGAATCCAAATCTTTTGTTGAACAAGACCATTTGGTCACGGAGATCGACTATCTTGCCAGAATTTGTTGATAGCACTGTCAAGATTTACAATGGGAAAACCACTATTCGTTGTAGGATCACTGAGGGAAAAGTGGGTCATAAGTTTGGAGAGTTTGCTCTCACCAGGAAACGCAAGACCAGAGAACAAGCCAATTCCAAAAATGTTAAACAACTTAAGAAAAAGAAGTGA

Predicted protein sequences of Glyma08g11250

Limit To All Plant Sequences

>Glyma08g11250.1   sequence type=predicted peptide   gene model=Glyma08g11250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRPTMMLRALTKQFLGIVGDTANTVAKKPPPPPPLVSRKPAFIDAFLYKMKKNPNLLLNKTIWSRRSTILPEFVDSTVKIYNGKTTIRCRITEGKVGHKFGEFALTRKRKTREQANSKNVKQLKKKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain