Glyma08g11090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g11090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g11090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g11090

Feature Type:	gene_model
Chromosome:	Gm08
Start:	8101495
stop:	8102554
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g11090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17230	AT	Annotation by Michelle Graham. TAIR10: PHYTOENE SYNTHASE \| chr5:5659839-5662087 REVERSE LENGTH=422	SoyBase	E_val: 2.00E-76	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
GO:0016765	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups	SoyBase	N/A	ISS
GO:0016767	GO-mf	Annotation by Michelle Graham. GO Molecular Function: geranylgeranyl-diphosphate geranylgeranyltransferase activity	SoyBase	N/A	ISS
GO:0046905	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phytoene synthase activity	SoyBase	N/A	ISS
PF00494	PFAM	Squalene/phytoene synthase	JGI		ISS
UniRef100_A1BQL6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase (Fragment) n=2 Tax=Cucumis sativus RepID=A1BQL6_CUCSA	SoyBase	E_val: 4.00E-78	ISS
UniRef100_UPI0002337FB0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337FB0 related cluster n=1 Tax=unknown RepID=UPI0002337FB0	SoyBase	E_val: 7.00E-93	ISS

Expression Patterns of Glyma08g11090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g11090 not represented in the dataset	Glyma08g11090 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g11090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g11090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g11090

Limit To All Plant Sequences

>Glyma08g11090.1   sequence type=CDS   gene model=Glyma08g11090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATCTTAAGAAGCCAAGATACAAAAACTTTGATGAACTATATCTTTGTTGTTACTATGTTGCTGGGACAGTTGGTATAATAAGTGTTCCAATCATGGGCATTTCACTAAATTCACAAGCCACAACAGAGAGTGTATACAATGCTGCCTTGGCCCTAGGAATTGCAAATCAGCTAACCAATATACTTAGAGATGTTGAAGAGGATGCTAACGGAGGAAGAGTGTATCTTCCACAAGATGAGTTGGCTCAAGCAGGGCTTTCAGATGAAGACATATTTGCTGGTAAGGTGACAGACAAGTGGAGGAACTTCATGAAGAACCAAATCAAAAGGGCAAAAATGTTTTTTGATGAGGCAAAAAAGGGGGTGACTGAGCTTAATGAAGCTAGCAGATGGCCA

Predicted protein sequences of Glyma08g11090

Limit To All Plant Sequences

>Glyma08g11090.1   sequence type=predicted peptide   gene model=Glyma08g11090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DLKKPRYKNFDELYLCCYYVAGTVGIISVPIMGISLNSQATTESVYNAALALGIANQLTNILRDVEEDANGGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKNQIKRAKMFFDEAKKGVTELNEASRWP

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain