SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g11090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g11090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g11090

Feature Type:gene_model
Chromosome:Gm08
Start:8101495
stop:8102554
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17230AT Annotation by Michelle Graham. TAIR10: PHYTOENE SYNTHASE | chr5:5659839-5662087 REVERSE LENGTH=422 SoyBaseE_val: 2.00E-76ISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016765GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups SoyBaseN/AISS
GO:0016767GO-mf Annotation by Michelle Graham. GO Molecular Function: geranylgeranyl-diphosphate geranylgeranyltransferase activity SoyBaseN/AISS
GO:0046905GO-mf Annotation by Michelle Graham. GO Molecular Function: phytoene synthase activity SoyBaseN/AISS
PF00494PFAM Squalene/phytoene synthase JGI ISS
UniRef100_A1BQL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase (Fragment) n=2 Tax=Cucumis sativus RepID=A1BQL6_CUCSA SoyBaseE_val: 4.00E-78ISS
UniRef100_UPI0002337FB0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337FB0 related cluster n=1 Tax=unknown RepID=UPI0002337FB0 SoyBaseE_val: 7.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g11090 not represented in the dataset

Glyma08g11090 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g11090.1   sequence type=CDS   gene model=Glyma08g11090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATCTTAAGAAGCCAAGATACAAAAACTTTGATGAACTATATCTTTGTTGTTACTATGTTGCTGGGACAGTTGGTATAATAAGTGTTCCAATCATGGGCATTTCACTAAATTCACAAGCCACAACAGAGAGTGTATACAATGCTGCCTTGGCCCTAGGAATTGCAAATCAGCTAACCAATATACTTAGAGATGTTGAAGAGGATGCTAACGGAGGAAGAGTGTATCTTCCACAAGATGAGTTGGCTCAAGCAGGGCTTTCAGATGAAGACATATTTGCTGGTAAGGTGACAGACAAGTGGAGGAACTTCATGAAGAACCAAATCAAAAGGGCAAAAATGTTTTTTGATGAGGCAAAAAAGGGGGTGACTGAGCTTAATGAAGCTAGCAGATGGCCA

>Glyma08g11090.1   sequence type=predicted peptide   gene model=Glyma08g11090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DLKKPRYKNFDELYLCCYYVAGTVGIISVPIMGISLNSQATTESVYNAALALGIANQLTNILRDVEEDANGGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKNQIKRAKMFFDEAKKGVTELNEASRWP







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo