SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g11070

Feature Type:gene_model
Chromosome:Gm08
Start:8087450
stop:8089503
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g11070
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27970AT Annotation by Michelle Graham. TAIR10: nuclear transport factor 2B | chr1:9746921-9747787 FORWARD LENGTH=126 SoyBaseE_val: 1.00E-75ISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005635GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008536GO-mf Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
KOG2104 KOG Nuclear transport factor 2 JGI ISS
PTHR12612Panther NUCLEAR TRANSPORT FACTOR 2 JGI ISS
PF02136PFAM Nuclear transport factor 2 (NTF2) domain JGI ISS
UniRef100_B9RMD1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transport factor, putative n=1 Tax=Ricinus communis RepID=B9RMD1_RICCO SoyBaseE_val: 6.00E-75ISS
UniRef100_C6TFP4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TFP4_SOYBN SoyBaseE_val: 2.00E-86ISS

Expression Patterns of Glyma08g11070
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g11070
ParalogEvidenceComments
Glyma05g28080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g11070 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g105100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g11070
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g11070
>Glyma08g11070.1   sequence type=CDS   gene model=Glyma08g11070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACAGCACCTTCGACACCAACAGGAACGGCTTAGCGAATCTCTACCAGGAGGGTTCCATGCTCACTTTCGAAGGGCAGAAGATCCAAGGCGCTTCCAACATCGTTGCCAAGCTCACCTCCCTCCCTTTTCAGCAGTGCCACCACTCAATCTCCACCGTCGACTGCCAGCCCTCCGGCGTCAACGCCGGCATGCTCGTCTTCGTCAGCGGAAACCTTCAGCTCGCCGGCGAACAGCACACTCTCAAGTTCAGCCAGATGTTCCATTTGATACCAACACCTCAGGGAAGCTATTATGTGTTGAATGACATATTCCGTTTAAACTATGCATGA
Predicted protein sequences of Glyma08g11070
>Glyma08g11070.1   sequence type=predicted peptide   gene model=Glyma08g11070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPDALAKAFVEHYYSTFDTNRNGLANLYQEGSMLTFEGQKIQGASNIVAKLTSLPFQQCHHSISTVDCQPSGVNAGMLVFVSGNLQLAGEQHTLKFSQMFHLIPTPQGSYYVLNDIFRLNYA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo