SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g10900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g10900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g10900

Feature Type:gene_model
Chromosome:Gm08
Start:7948324
stop:7950023
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G40042AT Annotation by Michelle Graham. TAIR10: Microsomal signal peptidase 12 kDa subunit (SPC12) | chr4:18559289-18559570 FORWARD LENGTH=93 SoyBaseE_val: 2.00E-41ISS
GO:0006465GO-bp Annotation by Michelle Graham. GO Biological Process: signal peptide processing SoyBaseN/AISS
GO:0005787GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signal peptidase complex SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG4112 KOG Signal peptidase subunit JGI ISS
PTHR13202Panther MICROSOMAL SIGNAL PEPTIDASE 12 KDA SUBUNIT JGI ISS
PF06645PFAM Microsomal signal peptidase 12 kDa subunit (SPC12) JGI ISS
UniRef100_B9RMF9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Signal peptidase complex subunit, putative n=1 Tax=Ricinus communis RepID=B9RMF9_RICCO SoyBaseE_val: 2.00E-39ISS
UniRef100_I1KS11UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KS11_SOYBN SoyBaseE_val: 5.00E-61ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g10900 not represented in the dataset

Glyma08g10900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g27920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g103600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g10900.1   sequence type=CDS   gene model=Glyma08g10900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGGCAAGGGCAAAAGCTAGCGGAGCAACTGATGCAGATAATGCTGCTTGCATTTGCTGTGATTGCATTTGTTGGTGGATATGTCATGGCTTCTTTCCAAATGATGATTCTCATATATGCTGGGGGTGTGGTTTTCACCACCTTGCTCACTGTCCCCAATTGGCCCCTTTTCAATCGCCATCCACTTACGTGGTTGGATCCAACTGAGGTGGAAAAGCATCCCAAGCCACAACCATCTGTCAATGTAACTCAAAAGAAGAAACCCGTTAAGAAGTAG

>Glyma08g10900.1   sequence type=predicted peptide   gene model=Glyma08g10900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDWQGQKLAEQLMQIMLLAFAVIAFVGGYVMASFQMMILIYAGGVVFTTLLTVPNWPLFNRHPLTWLDPTEVEKHPKPQPSVNVTQKKKPVKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo