Glyma08g10721 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g10721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g10721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g10721

Feature Type:	gene_model
Chromosome:	Gm08
Start:	7803188
stop:	7805791
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g10721

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G21250	AT	Annotation by Michelle Graham. TAIR10: multidrug resistance-associated protein 6 \| chr3:7457668-7463261 REVERSE LENGTH=1453	SoyBase	E_val: 8.00E-41	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0000325	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0042626	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances	SoyBase	N/A	ISS
PTHR24223	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24223:SF203	Panther		JGI		ISS
UniRef100_B9HTC0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Multidrug resistance protein ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9HTC0_POPTR	SoyBase	E_val: 3.00E-53	ISS
UniRef100_I1KRY8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRY8_SOYBN	SoyBase	E_val: 8.00E-68	ISS

Expression Patterns of Glyma08g10721

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g10721 not represented in the dataset	Glyma08g10721 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g10721 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g101700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g10721

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g10721

Limit To All Plant Sequences

>Glyma08g10721.1   sequence type=CDS   gene model=Glyma08g10721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTCTGTCCGAATCAATTTCCTCTTCAATATGGTCTTGTATTTTGTTCTTGTGCCATCTTCGTTACTTTGCCAAGGTCTACCATTCAAGATTGCAGGCCTGAACCAGAGTGGCCAAAGGAGGGAAAAGTTGAACTTCATAACCTTCATATACAGAATGACCCTGCTGCTCCTATGGTCCTCAAAGATGTTACTTGTATCTTCCCAGGACAAAAGAAAATTGGTATAGTAGACAGGACAGGGAATGGAAAATCTACGCTGGTGCAAGCCCTCTTTCAAGTGGTGGACCCTTATGAACGATGTATACTTATTGATGGTGTTGATATTTCCAAGATTGGTCTGCAAGTTTTGAGATGTAAGCTTGGTATAACCTTGTTTCTAGGTACTGTAAGGACTAACTTGGATCCTCTGGAACACCATGCAGATCAAGAACTTTGGGAGGTTCTCAGCAAGTGTCATCTTACTGAATTAGTTACGCAAGATCAAATTGAAGAAGAAATTGATTCGGACAGACAACCATTCCATGGTGCCAATATTGTGAAAGGCTACCCGAGAATGATCGTCAATTAG

Predicted protein sequences of Glyma08g10721

Limit To All Plant Sequences

>Glyma08g10721.1   sequence type=predicted peptide   gene model=Glyma08g10721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVCPNQFPLQYGLVFCSCAIFVTLPRSTIQDCRPEPEWPKEGKVELHNLHIQNDPAAPMVLKDVTCIFPGQKKIGIVDRTGNGKSTLVQALFQVVDPYERCILIDGVDISKIGLQVLRCKLGITLFLGTVRTNLDPLEHHADQELWEVLSKCHLTELVTQDQIEEEIDSDRQPFHGANIVKGYPRMIVN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain