SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G30270 | AT | Annotation by Michelle Graham. TAIR10: CBL-interacting protein kinase 23 | chr1:10655270-10658524 FORWARD LENGTH=482 | SoyBase | E_val: 1.00E-12 | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
| GO:0007584 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nutrient | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010107 | GO-bp | Annotation by Michelle Graham. GO Biological Process: potassium ion import | SoyBase | N/A | ISS |
| GO:0010118 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stomatal movement | SoyBase | N/A | ISS |
| GO:0016036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation | SoyBase | N/A | ISS |
| GO:0019375 | GO-bp | Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process | SoyBase | N/A | ISS |
| GO:0019722 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling | SoyBase | N/A | ISS |
| GO:0035556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction | SoyBase | N/A | ISS |
| GO:0042631 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| UniRef100_G7IIY1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting protein kinase n=2 Tax=Medicago truncatula RepID=G7IIY1_MEDTR | SoyBase | E_val: 3.00E-13 | ISS |
| UniRef100_I1L269 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L269_SOYBN | SoyBase | E_val: 5.00E-15 | ISS |
|
Glyma08g10475 not represented in the dataset |
Glyma08g10475 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g10475.1 sequence type=CDS gene model=Glyma08g10475 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGTATTGAAGGAGGGGCAAATGCTAGACGCAAAGGTCATCTTGCTATATTCATTAAGATTTCCGAGATAGCACAACCCTTTCACATGGTTGAGCTTCGGAAGGCTGAAGGAGATGTTCTGGAATTTCATAACTTCTGCAAGCATATATATGCTGCGTTGTCAGATTTTATTTGGAAAGGGAGAGCAGAACCTATAGATACAGAAACAGATGGTTAG
>Glyma08g10475.1 sequence type=predicted peptide gene model=Glyma08g10475 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSIEGGANARRKGHLAIFIKISEIAQPFHMVELRKAEGDVLEFHNFCKHIYAALSDFIWKGRAEPIDTETDG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
