SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g10381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g10381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g10381

Feature Type:gene_model
Chromosome:Gm08
Start:7517529
stop:7518974
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g10381
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30220AT Annotation by Michelle Graham. TAIR10: inositol transporter 2 | chr1:10632957-10635439 REVERSE LENGTH=580 SoyBaseE_val: 7.00E-30ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006863GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport SoyBaseN/AISS
GO:0015798GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol transport SoyBaseN/AISS
GO:0023052GO-bp Annotation by Michelle Graham. GO Biological Process: signaling SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0090406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0005366GO-mf Annotation by Michelle Graham. GO Molecular Function: myo-inositol:hydrogen symporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
UniRef100_G7IGM5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carbohydrate transporter/sugar porter n=1 Tax=Medicago truncatula RepID=G7IGM5_MEDTR SoyBaseE_val: 4.00E-31ISS
UniRef100_UPI0002337E2AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337E2A related cluster n=1 Tax=unknown RepID=UPI0002337E2A SoyBaseE_val: 2.00E-40ISS

Expression Patterns of Glyma08g10381
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g10381 not represented in the dataset
Glyma08g10381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g10381 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g098300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g10381
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g10381
>Glyma08g10381.1   sequence type=CDS   gene model=Glyma08g10381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGAGGTGTCCCTGAAGCTGATGGCTCTGCTTTCAAAGAGTGCATTTCTCTTTCAAAGAACAACCCTTATGTTCTTCGCCTTGCTTTTTCTGCTGGAATTGGAGGCCTTCTCTTTGACTATGACACTGGTGTGATATCTGGGTCTCTTTTGTATATCAGAGAAGATTTCAAAGATGTGGACAGAAAGACTTGGCTTCAGGGAAAGCAAGAAGAAGGTATACAAATTTTGTGA
Predicted protein sequences of Glyma08g10381
>Glyma08g10381.1   sequence type=predicted peptide   gene model=Glyma08g10381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGVPEADGSAFKECISLSKNNPYVLRLAFSAGIGGLLFDYDTGVISGSLLYIREDFKDVDRKTWLQGKQEEGIQIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo